Comparing PP_2112 FitnessBrowser__Putida:PP_2112 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
57% identity, 99% coverage: 5:911/913 of query aligns to 11:906/909 of P09339
Sites not aligning to the query:
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
56% identity, 100% coverage: 3:913/913 of query aligns to 10:941/943 of A0QX20
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
56% identity, 96% coverage: 35:910/913 of query aligns to 128:987/990 of Q9SIB9
Sites not aligning to the query:
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
52% identity, 99% coverage: 10:910/913 of query aligns to 12:887/889 of P21399
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
52% identity, 99% coverage: 10:910/913 of query aligns to 11:886/888 of 2b3xA
3snpA Crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire RNA (see paper)
51% identity, 96% coverage: 37:910/913 of query aligns to 33:848/850 of 3snpA
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
28% identity, 91% coverage: 79:906/913 of query aligns to 85:772/778 of P19414
Sites not aligning to the query:
8acnA Crystal structures of aconitase with isocitrate and nitroisocitrate bound (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 8acnA
1fghA Complex with 4-hydroxy-trans-aconitate (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1fghA
1amjA Steric and conformational features of the aconitase mechanism (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1amjA
1amiA Steric and conformational features of the aconitase mechanism (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1amiA
1acoA Crystal structure of aconitase with transaconitate bound (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1acoA
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
27% identity, 91% coverage: 74:904/913 of query aligns to 84:773/780 of P20004
1nisA Crystal structure of aconitase with trans-aconitate and nitrocitrate bound (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1nisA
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 57:746/754 of 5acnA
P16276 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Sus scrofa (Pig) (see 3 papers)
27% identity, 91% coverage: 74:904/913 of query aligns to 84:773/781 of P16276
Sites not aligning to the query:
1b0kA S642a:fluorocitrate complex of aconitase (see paper)
27% identity, 91% coverage: 74:904/913 of query aligns to 56:745/753 of 1b0kA
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 62% coverage: 30:597/913 of query aligns to 46:523/789 of P39533
Sites not aligning to the query:
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 69% coverage: 207:833/913 of query aligns to 135:655/758 of O14289
4nqyA The reduced form of mj0499 (see paper)
23% identity, 44% coverage: 178:583/913 of query aligns to 86:404/409 of 4nqyA
Sites not aligning to the query:
>PP_2112 FitnessBrowser__Putida:PP_2112
MPSLDSLNTLKPLKVGDKTYHYFSLTEAARQLGDLQRLPMSLKVLLENLLRWEDGATVTG
DDLRAIAQWLGERRSDREIQYRPARVLMQDFTGVPAVVDLAAMRAAMAKAGGDPQRINPL
SPVDLVIDHSVMVDRYGTPQAFAENVDIEMQRNGERYAFLRWGQSAFDNFRVVPPGTGIC
HQVNLEYLGRTVWTREADGRTYAFPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQ
PVSMLIPEVIGFKLTGKLREGITATDLVLTVTQMLRKKGVVGKFVEFYGDGLAELPLADR
ATIANMAPEYGATCGFFPVDQVTLDYLRLSGRPEATVQLVEQYCKAQGMWRLPGQEPSFS
DTLALDMDDVEASLAGPKRPQDRVALGQVSQAFDHFIELQPKPLAKEVGRLESEGGGGVA
VGNADQTGAVDYSHQGQTHTLRDGAVVIAAITSCTNTSNPSVMMAAGLVAKKALEKGLQR
KPWVKSSLAPGSKVVTDYFKAAGLTPYLDQLGFDLVGYGCTTCIGNSGPLDEAIEKAIGS
ADLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGSVRLDLTRDPLGSGKDGQP
VYLRDIWPSQQEIAEAVAKVDTAMFHKEYAEVFAGDAQWQAIEVPQAATYVWQADSTYIQ
HPPFFDGIGGPPPQIANIHGARVLALLGDSVTTDHISPAGNIKTDSPAGRYLREQGVEPR
DFNSYGSRRGNHEVMMRGTFANIRIRNEMLAGEEGGNTLHVPTGEKLSIYDAAMRYQQEG
TPLLVIAGQEYGTGSSRDWAAKGTNLLGVKAVLAESFERIHRSNLVGMGVLPLQFKAGHN
RKQLGLTGKEQIDVLGLDGAHIHPGMSLPLRITREDGQQEQIEVLCRIDTLNEVEYFKAG
GILHYVLRQMIAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory