SitesBLAST
Comparing PP_2184 FitnessBrowser__Putida:PP_2184 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
65% identity, 98% coverage: 5:520/525 of query aligns to 2:514/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G157), G156 (= G159), K165 (= K168), N182 (= N185), E185 (= E188), G273 (= G276), E274 (= E277), E275 (= E278), N309 (≠ H312), N310 (= N313), S313 (≠ T316), A490 (= A496), M491 (= M497)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A161), F160 (= F163), K165 (= K168), T168 (= T171), E275 (= E278), L295 (= L298)
- binding iron/sulfur cluster: V271 (≠ I274), V289 (= V292), S442 (= S445), C443 (= C446), G444 (= G447), K445 (= K448), C446 (= C449), C449 (= C452), L488 (= L494), C489 (= C495), M491 (= M497), G492 (= G498)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
60% identity, 97% coverage: 8:516/525 of query aligns to 1:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G157), R147 (= R158), G148 (= G159), N174 (= N185), D176 (= D187), E177 (= E188), Y254 (= Y273), G257 (= G276), E258 (= E277), N293 (≠ H312), N294 (= N313), S297 (≠ T316)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F163), K157 (= K168), E258 (= E277), E259 (= E278), L279 (= L298), K466 (≠ Q490), L470 (= L494)
- binding iron/sulfur cluster: S426 (= S445), C427 (= C446), G428 (= G447), T429 (≠ K448), C430 (= C449), C433 (= C452), L470 (= L494), C471 (= C495), G474 (= G498)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
39% identity, 97% coverage: 8:516/525 of query aligns to 1:509/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ V17), C41 (≠ S48), C45 (≠ Y52)
- binding flavin mononucleotide: R154 (= R158), K164 (= K168), N181 (= N185), F269 (≠ Y273), E273 (= E277), E274 (= E278), I307 (≠ V311), N308 (≠ H312), N309 (= N313), G489 (≠ A496), L490 (≠ M497)
- binding nicotinamide-adenine-dinucleotide: G155 (= G159), G156 (= G160), F159 (= F163), F163 (≠ I167), E273 (= E277), E274 (= E278), K291 (= K295), F294 (≠ L298), G413 (= G417)
- binding iron/sulfur cluster: P288 (≠ V292), C442 (= C446), G443 (= G447), C445 (= C449), C448 (= C452), C488 (= C495), L490 (≠ M497), G491 (= G498)
- binding zinc ion: C425 (≠ N429)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
43% identity, 80% coverage: 99:516/525 of query aligns to 141:555/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G159), N227 (= N185), E230 (= E188), N355 (= N313), G535 (≠ A496), L536 (≠ M497)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E278), R337 (≠ K295), R340 (≠ L298), T341 (≠ P299), N342 (≠ A300), S433 (≠ L391)
- binding iron/sulfur cluster: S487 (= S445), C488 (= C446), G489 (= G447), C491 (= C449), C494 (= C452), C534 (= C495), L536 (≠ M497), G537 (= G498)
- binding zinc ion: C471 (≠ N429)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
40% identity, 98% coverage: 5:516/525 of query aligns to 23:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P13), G33 (≠ D15), T34 (≠ S16), C36 (≠ A18), C67 (≠ S48), C68 (≠ R49), G69 (= G50), R70 (≠ L51), C71 (≠ Y52)
- binding flavin mononucleotide: G185 (= G157), R186 (= R158), G187 (= G159), N213 (= N185), D215 (= D187), E216 (= E188), G217 (= G189), F301 (≠ Y273), G304 (= G276), E305 (= E277), E306 (= E278), N340 (≠ H312), N341 (= N313), G521 (≠ A496), L522 (≠ M497)
- binding iron/sulfur cluster: P320 (≠ V292), S473 (= S445), C474 (= C446), G475 (= G447), K476 (= K448), C477 (= C449), C480 (= C452), L519 (= L494), C520 (= C495), L522 (≠ M497), G523 (= G498)
- binding zinc ion: C457 (≠ N429)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
44% identity, 82% coverage: 89:516/525 of query aligns to 100:524/599 of 7q4vB
- binding flavin mononucleotide: G166 (= G157), G168 (= G159), N196 (= N185), D198 (= D187), F284 (≠ Y273), G287 (= G276), E288 (= E277), E289 (= E278), N324 (= N313)
- binding iron/sulfur cluster: C457 (= C446), G458 (= G447), K459 (= K448), C460 (= C449), C463 (= C452), C503 (= C495), G506 (= G498)
- binding zinc ion: C440 (≠ N429)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
44% identity, 78% coverage: 107:516/525 of query aligns to 3:410/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ N429), C364 (≠ A468)
- binding flavin mononucleotide: G54 (= G157), G56 (= G159), K65 (= K168), N82 (= N185), D84 (= D187), E85 (= E188), G173 (= G276), E175 (= E278), N210 (= N313), G390 (≠ A496), L391 (≠ M497)
- binding nicotinamide-adenine-dinucleotide: G56 (= G159), G57 (= G160), A58 (= A161), F60 (= F163), K65 (= K168), F68 (≠ T171), E85 (= E188), E175 (= E278), R192 (≠ K295), F195 (≠ L298), I312 (≠ M415), M313 (≠ L416), S315 (≠ H418)
- binding iron/sulfur cluster: S342 (= S445), C343 (= C446), G344 (= G447), C346 (= C449), C349 (= C452), S387 (= S493), C389 (= C495), L391 (≠ M497), G392 (= G498)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
44% identity, 78% coverage: 107:516/525 of query aligns to 3:410/425 of 7t2rB
Sites not aligning to the query:
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
45% identity, 75% coverage: 122:516/525 of query aligns to 1:395/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G157), G39 (= G159), N67 (= N185), G158 (= G276), E159 (= E277), E160 (= E278), G375 (≠ A496)
- binding nicotinamide-adenine-dinucleotide: G40 (= G160), F43 (= F163), K48 (= K168), R177 (≠ K295), F180 (≠ L298), M297 (= M415)
- binding iron/sulfur cluster: S327 (= S445), C328 (= C446), G329 (= G447), K330 (= K448), C331 (= C449), C334 (= C452), L373 (= L494), C374 (= C495)
- binding zinc ion: C311 (≠ N429)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
47% identity, 71% coverage: 145:516/525 of query aligns to 2:372/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G157), G16 (= G159), N44 (= N185), G135 (= G276), E137 (= E278), N171 (≠ H312), N172 (= N313), G352 (≠ A496)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G159), G17 (= G160), F20 (= F163), K25 (= K168), F28 (≠ T171), D49 (= D190), R154 (≠ K295), F157 (≠ L298), S250 (≠ L391)
- binding iron/sulfur cluster: P151 (≠ V292), C305 (= C446), G306 (= G447), K307 (= K448), C308 (= C449), C311 (= C452), C351 (= C495), G354 (= G498)
- binding zinc ion: C288 (≠ N429)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
41% identity, 76% coverage: 119:516/525 of query aligns to 22:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G157), G63 (= G159), K72 (= K168), N90 (= N185), D92 (= D187), G181 (= G276), E182 (= E277), N217 (≠ H312), N218 (= N313), A399 (= A496), H400 (≠ M497)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G159), G64 (= G160), A65 (= A161), F67 (= F163), K72 (= K168), L75 (≠ T171), E95 (≠ D190), Y178 (= Y273), E183 (= E278), F203 (≠ L298), R320 (≠ M415), T323 (≠ H418)
- binding iron/sulfur cluster: S350 (= S445), C351 (= C446), W353 (≠ K448), C354 (= C449), C357 (= C452), F397 (≠ L494), C398 (= C495), H400 (≠ M497)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
41% identity, 78% coverage: 108:516/525 of query aligns to 13:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G157), K74 (= K168), N91 (= N185), D93 (= D187), Y179 (= Y273), G182 (= G276), E183 (= E277), N218 (≠ H312), N219 (= N313), L401 (≠ M497)
- binding iron/sulfur cluster: I180 (= I274), P198 (≠ V292), S351 (= S445), C352 (= C446), G353 (= G447), K354 (= K448), C355 (= C449), C358 (= C452), F398 (≠ L494), C399 (= C495), L401 (≠ M497)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
41% identity, 78% coverage: 108:516/525 of query aligns to 13:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G157), G65 (= G159), N91 (= N185), D93 (= D187), G182 (= G276), E183 (= E277), E184 (= E278), N218 (≠ H312), N219 (= N313), T222 (= T316), P400 (≠ A496)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G159), G66 (= G160), F69 (= F163), K74 (= K168), F77 (≠ T171), E96 (≠ D190), Y179 (= Y273), E184 (= E278), K201 (= K295), F204 (≠ L298), T324 (≠ H418)
- binding iron/sulfur cluster: S351 (= S445), C352 (= C446), K354 (= K448), C355 (= C449), C358 (= C452), F398 (≠ L494), C399 (= C495), L401 (≠ M497), A402 (≠ G498)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 78% coverage: 108:516/525 of query aligns to 14:421/438 of Q56222
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
39% identity, 79% coverage: 103:516/525 of query aligns to 9:412/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G157), G65 (= G159), K74 (= K168), N90 (= N185), D92 (= D187), E93 (= E188), G181 (= G276), E182 (= E277), E183 (= E278), V216 (= V311), N217 (≠ H312), N218 (= N313), T221 (= T316)
- binding nicotinamide-adenine-dinucleotide: G65 (= G159), G66 (= G160), A67 (= A161), F69 (= F163), K74 (= K168), E95 (≠ D190), Y178 (= Y273), E183 (= E278), K200 (= K295), Y203 (≠ L298)
- binding iron/sulfur cluster: I179 (= I274), P197 (≠ V292), T344 (≠ S445), C345 (= C446), G346 (= G447), Q347 (≠ K448), C348 (= C449), C351 (= C452), S389 (= S493), I390 (≠ L494), C391 (= C495), L393 (≠ M497), G394 (= G498)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
39% identity, 79% coverage: 103:516/525 of query aligns to 11:414/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G157), G67 (= G159), K76 (= K168), N92 (= N185), E95 (= E188), Y180 (= Y273), G183 (= G276), E184 (= E277), V218 (= V311), N219 (≠ H312), N220 (= N313), T223 (= T316)
- binding iron/sulfur cluster: T346 (≠ S445), C347 (= C446), G348 (= G447), Q349 (≠ K448), C350 (= C449), C353 (= C452), S391 (= S493), I392 (≠ L494), C393 (= C495), G396 (= G498)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
39% identity, 79% coverage: 103:516/525 of query aligns to 10:413/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G157), G66 (= G159), K75 (= K168), N91 (= N185), D93 (= D187), E94 (= E188), G182 (= G276), E183 (= E277), E184 (= E278), V217 (= V311), N218 (≠ H312), N219 (= N313), T222 (= T316), G393 (≠ A496)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G159), G67 (= G160), A68 (= A161), F70 (= F163), K75 (= K168), E94 (= E188), E96 (≠ D190), Y179 (= Y273), E184 (= E278), Y204 (≠ L298)
- binding iron/sulfur cluster: P198 (≠ V292), T345 (≠ S445), C346 (= C446), G347 (= G447), Q348 (≠ K448), C349 (= C449), C352 (= C452), I391 (≠ L494), C392 (= C495), L394 (≠ M497), G395 (= G498)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
39% identity, 79% coverage: 103:516/525 of query aligns to 10:413/419 of 6saqB
- binding flavin mononucleotide: G64 (= G157), G66 (= G159), K75 (= K168), N91 (= N185), D93 (= D187), E94 (= E188), Y179 (= Y273), G182 (= G276), E183 (= E277), N218 (≠ H312), N219 (= N313), T222 (= T316)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G159), G67 (= G160), A68 (= A161), F70 (= F163), K75 (= K168), E94 (= E188), E96 (≠ D190), T99 (= T193), E184 (= E278), Y204 (≠ L298), T318 (≠ H418)
- binding iron/sulfur cluster: P198 (≠ V292), T345 (≠ S445), C346 (= C446), G347 (= G447), Q348 (≠ K448), C349 (= C449), C352 (= C452), I391 (≠ L494), C392 (= C495), G395 (= G498)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
43% identity, 76% coverage: 119:516/525 of query aligns to 15:417/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G157), R54 (= R158), G55 (= G159), A57 (= A161), K64 (= K168), N90 (= N185), D92 (= D187), Y178 (= Y273), G181 (= G276), E182 (= E277), E183 (= E278), N217 (≠ H312), N218 (= N313), S221 (≠ T316), L398 (≠ M497)
- binding iron/sulfur cluster: P197 (≠ V292), S349 (= S445), C350 (= C446), G351 (= G447), K352 (= K448), C353 (= C449), C356 (= C452), S394 (= S493), F395 (≠ L494), C396 (= C495), L398 (≠ M497), G399 (= G498)
- binding zinc ion: C333 (≠ N429), E371 (≠ I467)
Sites not aligning to the query:
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
38% identity, 71% coverage: 139:512/525 of query aligns to 48:422/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G157), G69 (= G159), K78 (= K168), N96 (= N185), D98 (= D187), E99 (= E188), G187 (= G276), E188 (= E277), N224 (= N313), A406 (= A496)
- binding iron/sulfur cluster: I185 (= I274), P203 (≠ V292), C359 (= C446), Q361 (≠ K448), C362 (= C449), C365 (= C452), T403 (≠ S493), I404 (≠ L494), C405 (= C495), L407 (≠ M497)
- binding : Y143 (≠ P232), N144 (≠ D233), Q150 (≠ D239), D174 (= D263)
Query Sequence
>PP_2184 FitnessBrowser__Putida:PP_2184
MPGGLSMLKLYIPCDSVARAVGADQVAEALLREAERRQLPLDIQRTSSRGLYWLEPLIEC
DSAQGRLGFGPITPHDVPSLLDALAGEPGGHSLALGPVEEIPYLKTQQRLLFARAGITRP
LSLDDYRANGGFAGLEAAVALDGAEVVAAVLDSGLRGRGGAAFPAGIKWRTVRDAGAGQK
YVVCNADEGDSGTFADRMLMEGDPFLLIEGMIIAGLAVGADKGYIYVRSEYPDAIRVLDQ
AFAIARDAGYLGADVAGSGQAFDLEVRVGAGAYICGEETALLESIEGKRGIVRAKPPLPA
LQGLFGLPTLVHNVLTLASVPIILAKGAAFYRDFGMGRSLGTMPFQLAGNIRQGGLVERA
FGLTLRELVEGYGGGTASGRPLKAAQVGGPLGAWVPPSHFDTPLDYEAFAAVGAMLGHGG
VVVADDTLNMASMARFALQFCAEESCGKCTPCRIGSTRGMEVVDRLIASSDITERHDQAL
LLRDLCDTLQYGSLCAMGGMTAYPVASALKYFPADFGLTTTEAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory