SitesBLAST
Comparing PP_2185 FitnessBrowser__Putida:PP_2185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
67% identity, 98% coverage: 7:946/960 of query aligns to 1:948/949 of 6tg9A
- active site: K289 (= K287), C380 (= C378), H381 (= H379), L545 (= L543), G582 (= G580), Q583 (= Q581)
- binding fe2/s2 (inorganic) cluster: C51 (= C58), V59 (≠ F66), G60 (= G67), C62 (= C69), C65 (= C72), C79 (= C86)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C253), K289 (= K287), R351 (= R349), C352 (= C350), C380 (= C378), G414 (= G412), A415 (= A413), D419 (= D417), G420 (≠ A418), H421 (= H419), P443 (= P441), R444 (= R442), P464 (= P462), N467 (= N465), L545 (= L543), G546 (= G544), H550 (= H548), G582 (= G580), Q583 (= Q581), Q583 (= Q581), G649 (= G647), E650 (= E648), S655 (= S653), N680 (= N678), S693 (= S691), K698 (= K696), D724 (= D722), T820 (= T818), T821 (= T819), R823 (= R821), R823 (= R821), I824 (= I822), L825 (= L823), N829 (= N827), V830 (= V828), Q833 (= Q831), N902 (= N900), Y918 (= Y916), K919 (= K917)
- binding iron/sulfur cluster: H111 (= H118), C115 (= C122), C118 (= C125), A120 (= A127), C124 (= C131), C176 (= C173), I177 (= I174), V178 (= V175), C179 (= C176), M180 (≠ S177), C182 (= C179), C186 (= C183), I206 (≠ V203), C218 (= C216), S220 (= S218), C221 (= C219), G222 (= G220), C224 (= C222), C228 (= C226), T230 (= T228), A231 (= A229), C252 (= C250), Y254 (= Y252), C255 (= C253), V257 (= V255), C259 (= C257), F261 (= F259), C287 (= C285), K289 (= K287), V423 (= V421)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
37% identity, 94% coverage: 26:924/960 of query aligns to 2:911/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (≠ K56), C34 (= C58), H35 (≠ A59), G45 (= G67), C47 (= C69), R48 (= R70), C50 (= C72), C64 (= C86)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K287), K339 (≠ R349), C364 (= C374), C368 (= C378), G402 (= G412), N404 (= N414), N408 (≠ A418), D431 (= D440), P432 (= P441), R433 (= R442), F447 (≠ L460), G450 (= G463), D452 (≠ N465), G525 (= G542), M526 (≠ L543), G527 (= G544), Q530 (≠ E547), H531 (= H548), G563 (= G580), Q564 (= Q581), G630 (= G647), N632 (≠ D649), S636 (= S653), Q656 (= Q673), D657 (= D674), L658 (≠ I675), T805 (= T819), R807 (= R821), R807 (= R821), V808 (≠ I822), L809 (= L823), H811 (≠ Q825), W812 (≠ Y826), H813 (≠ N827), H813 (≠ N827), T814 (≠ V828), M817 (≠ Q831), F879 (= F892), N887 (= N900), F903 (≠ Y916), K904 (= K917)
- binding iron/sulfur cluster: C145 (= C173), I146 (= I174), Q147 (≠ V175), C148 (= C176), N149 (≠ S177), C151 (= C179), C155 (= C183), N161 (≠ T189), V163 (≠ A191), I164 (≠ L192), V175 (= V203), C188 (= C216), V189 (= V217), A190 (≠ S218), C191 (= C219), G192 (= G220), C194 (= C222), C198 (= C226), P199 (= P227), T200 (= T228), A202 (≠ T230), L203 (= L231), C227 (= C250), C230 (= C253), C234 (= C257), C261 (= C285), K263 (= K287), G264 (= G288), V411 (= V421)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
38% identity, 74% coverage: 244:950/960 of query aligns to 2:708/715 of 1fdiA
- active site: C11 (= C253), L41 (≠ A284), C42 (= C285), K44 (= K287), S108 (= S347), R110 (= R349), D134 (= D372), C140 (= C378), H141 (= H379), S180 (≠ A418), M297 (≠ L543), R333 (= R579), G334 (= G580), Q335 (= Q581)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K287), R110 (= R349), G111 (≠ C350), V139 (= V377), C140 (= C378), F173 (≠ I411), G174 (= G412), Y175 (≠ A413), N176 (= N414), D179 (= D417), S180 (≠ A418), C201 (≠ I439), D202 (= D440), P203 (= P441), R204 (= R442), L218 (= L460), G221 (= G463), N223 (= N465), G296 (= G542), M297 (≠ L543), G298 (= G544), F302 (≠ H548), G334 (= G580), Q335 (= Q581), Q335 (= Q581), G402 (= G647), E403 (= E648), T408 (≠ S653), Q428 (= Q673), D429 (= D674), I430 (= I675), S445 (≠ G690), D478 (= D722), T579 (= T819), V580 (≠ G820), R581 (= R821), R581 (= R821), E582 (≠ I822), H585 (≠ Q825), Y586 (= Y826), S587 (≠ N827), C588 (≠ V828), Y654 (≠ F892), N662 (= N900), Y678 (= Y916), K679 (= K917)
- binding nitrite ion: C140 (= C378), H141 (= H379), R333 (= R579), G334 (= G580), V338 (= V584)
- binding iron/sulfur cluster: C8 (= C250), Y10 (= Y252), C11 (= C253), S13 (≠ V255), C15 (= C257), L41 (≠ A284), C42 (= C285), K44 (= K287), P182 (= P420), I183 (≠ V421)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 74% coverage: 244:950/960 of query aligns to 2:708/715 of P07658
- C8 (= C250) binding
- Y10 (= Y252) binding
- C11 (= C253) binding
- C15 (= C257) binding
- C42 (= C285) binding
- K44 (= K287) binding
- U140 (≠ C378) modified: nonstandard, Selenocysteine
- M297 (≠ L543) binding
- Q301 (≠ E547) binding
- Q335 (= Q581) binding
- S445 (≠ G690) binding
- D478 (= D722) binding
- C588 (≠ V828) binding
- Y654 (≠ F892) binding
- Q655 (≠ H893) binding
- Y678 (= Y916) binding
- K679 (= K917) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
37% identity, 74% coverage: 244:950/960 of query aligns to 2:690/697 of 2iv2X
- active site: C11 (= C253), L41 (≠ A284), C42 (= C285), K44 (= K287), S108 (= S347), C140 (= C378), H141 (= H379), S180 (≠ A418), M297 (≠ L543), R333 (= R579), G334 (= G580), Q335 (= Q581)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (= R349), G111 (≠ C350), T112 (= T351), A137 (= A375), Q335 (= Q581), G402 (= G647), E403 (= E648), D404 (= D649), T408 (≠ S653), A410 (≠ P655), Q428 (= Q673), D429 (= D674), I430 (= I675), S445 (≠ G690), D478 (= D722), C588 (≠ V828), Y660 (= Y916)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K287), F173 (≠ I411), G174 (= G412), Y175 (≠ A413), N176 (= N414), D179 (= D417), S180 (≠ A418), D202 (= D440), P203 (= P441), R204 (= R442), N223 (= N465), G296 (= G542), M297 (≠ L543), F302 (≠ H548), G334 (= G580), R581 (= R821), E582 (≠ I822), V583 (≠ L823), H585 (≠ Q825), Y586 (= Y826), S587 (≠ N827), K661 (= K917)
- binding iron/sulfur cluster: C8 (= C250), C11 (= C253), S13 (≠ V255), C15 (= C257), L41 (≠ A284), C42 (= C285), K44 (= K287), G45 (= G288), I183 (≠ V421)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
40% identity, 60% coverage: 243:820/960 of query aligns to 1:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
37% identity, 58% coverage: 244:801/960 of query aligns to 5:543/549 of 7bkbD
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
30% identity, 72% coverage: 235:925/960 of query aligns to 30:754/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 71% coverage: 241:925/960 of query aligns to 1:719/720 of 2jiqA
- active site: K46 (= K287), S106 (= S347), C137 (= C378), M138 (≠ H379), A177 (= A418), M305 (≠ L543), T341 (≠ R579), G342 (= G580), Q343 (= Q581)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A251), Q108 (≠ R349), C137 (= C378), G171 (= G412), S172 (≠ A413), E176 (≠ D417), A177 (= A418), D201 (= D440), P202 (= P441), R203 (= R442), P219 (= P462), D222 (≠ N465), C304 (≠ G542), M305 (≠ L543), G306 (= G544), Q309 (≠ E547), R310 (≠ H548), G342 (= G580), Q343 (= Q581), Q343 (= Q581), E413 (≠ G647), T414 (≠ E648), N415 (≠ D649), T419 (≠ S653), I440 (≠ Q673), E441 (≠ D674), F443 (= F676), P458 (≠ G690), F460 (≠ S692), S612 (≠ T819), M613 (≠ G820), R614 (= R821), R614 (= R821), I616 (≠ L823), H618 (≠ Q825), W619 (≠ Y826), H620 (≠ N827), H620 (≠ N827), T621 (≠ V828), T623 (≠ A830), F686 (= F892), N694 (= N900), Y710 (= Y916), K711 (= K917)
- binding nitrate ion: M251 (≠ I487), K583 (vs. gap), V589 (≠ R796), W591 (≠ M798), R593 (≠ T800), V704 (≠ A910)
- binding iron/sulfur cluster: C10 (= C250), C13 (= C253), T15 (≠ V255), C17 (= C257), L43 (≠ A284), C44 (= C285), V180 (= V421)
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 71% coverage: 241:925/960 of query aligns to 4:722/723 of 2v45A
- active site: K49 (= K287), S109 (= S347), C140 (= C378), M141 (≠ H379), A180 (= A418), M308 (≠ L543), T344 (≠ R579), G345 (= G580), Q346 (= Q581)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ A251), K49 (= K287), Q111 (≠ R349), C140 (= C378), G174 (= G412), N176 (= N414), E179 (≠ D417), A180 (= A418), D204 (= D440), P205 (= P441), R206 (= R442), P222 (= P462), D225 (≠ N465), C307 (≠ G542), M308 (≠ L543), G309 (= G544), Q312 (≠ E547), R313 (≠ H548), G345 (= G580), Q346 (= Q581), Q346 (= Q581), E416 (≠ G647), T417 (≠ E648), N418 (≠ D649), T422 (≠ S653), I443 (≠ Q673), E444 (≠ D674), A445 (≠ I675), F446 (= F676), P461 (≠ G690), F463 (≠ S692), S615 (≠ T819), M616 (≠ G820), R617 (= R821), R617 (= R821), V618 (≠ I822), I619 (≠ L823), H621 (≠ Q825), W622 (≠ Y826), H623 (≠ N827), H623 (≠ N827), T624 (≠ V828), T626 (≠ A830), F689 (= F892), N697 (= N900), Y713 (= Y916), K714 (= K917)
- binding iron/sulfur cluster: C13 (= C250), C16 (= C253), T18 (≠ V255), C20 (= C257), L46 (≠ A284), C47 (= C285), V183 (= V421)
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
30% identity, 71% coverage: 241:925/960 of query aligns to 1:719/720 of 2jirA
- active site: K46 (= K287), S106 (= S347), C137 (= C378), M138 (≠ H379), A177 (= A418), M305 (≠ L543), T341 (≠ R579), G342 (= G580), Q343 (= Q581)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A251), K46 (= K287), Q108 (≠ R349), C137 (= C378), G171 (= G412), S172 (≠ A413), N173 (= N414), E176 (≠ D417), A177 (= A418), D201 (= D440), P202 (= P441), R203 (= R442), F217 (≠ L460), D222 (≠ N465), C304 (≠ G542), M305 (≠ L543), G306 (= G544), Q309 (≠ E547), R310 (≠ H548), G342 (= G580), Q343 (= Q581), Q343 (= Q581), E413 (≠ G647), T414 (≠ E648), N415 (≠ D649), T419 (≠ S653), I440 (≠ Q673), E441 (≠ D674), A442 (≠ I675), P458 (≠ G690), F460 (≠ S692), S612 (≠ T819), M613 (≠ G820), R614 (= R821), R614 (= R821), I616 (≠ L823), H618 (≠ Q825), W619 (≠ Y826), H620 (≠ N827), H620 (≠ N827), T621 (≠ V828), T623 (≠ A830), F686 (= F892), N694 (= N900), Y710 (= Y916), K711 (= K917)
- binding nitrite ion: V615 (≠ I822), F686 (= F892)
- binding iron/sulfur cluster: C10 (= C250), C13 (= C253), T15 (≠ V255), C17 (= C257), L43 (≠ A284), C44 (= C285), P179 (= P420), V180 (= V421)
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
26% identity, 72% coverage: 25:716/960 of query aligns to 3:618/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C58), G45 (= G67), C47 (= C69), R48 (= R70), C50 (= C72), C64 (= C86)
- binding iron/sulfur cluster: F93 (≠ I115), H98 (≠ L120), F99 (≠ D121), C100 (= C122), C103 (= C125), Q105 (≠ A127), C109 (= C131), L141 (≠ F166), R147 (≠ K172), C148 (= C173), L150 (≠ V175), C151 (= C176), Q152 (≠ S177), C154 (= C179), C158 (= C183), C192 (= C216), V193 (= V217), N194 (≠ S218), C195 (= C219), G196 (= G220), A197 (= A221), C198 (= C222), C202 (= C226), P203 (= P227), T204 (= T228), G205 (≠ A229), T206 (= T230), I207 (≠ L231), C229 (= C250), C232 (= C253), G235 (= G256), C236 (= C257), L263 (≠ A284), C264 (= C285), V396 (= V421)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
29% identity, 64% coverage: 162:775/960 of query aligns to 602:1125/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C173), V614 (≠ I174), L615 (≠ V175), C616 (= C176), G617 (≠ S177), C619 (= C179), C623 (= C183), I643 (≠ V203), C656 (= C216), I657 (≠ V217), S658 (= S218), C659 (= C219), G660 (= G220), C662 (= C222), C666 (= C226), G669 (≠ A229), A670 (≠ T230), C692 (= C250), Y694 (= Y252), C695 (= C253), C699 (= C257), C725 (= C285), R727 (≠ K287), G728 (= G288), V853 (= V421)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
Q53176 Periplasmic nitrate reductase; EC 1.9.6.1 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
26% identity, 71% coverage: 250:926/960 of query aligns to 48:831/831 of Q53176
- C48 (= C250) binding
- C51 (= C253) binding
- C55 (= C257) binding
- C83 (= C285) binding
- K85 (= K287) binding
- Q152 (≠ R349) binding
- N177 (≠ C374) binding
- C181 (= C378) binding
- 214:221 (vs. 411:418, 25% identical) binding
- GTD 264:266 (≠ GTN 463:465) binding
- M375 (≠ L543) binding
- Q379 (≠ E547) binding
- N485 (≠ D649) binding
- SD 511:512 (≠ QD 673:674) binding
- K534 (= K696) binding
- D561 (≠ R709) binding
- 721:730 (vs. 819:828, 40% identical) binding
- N805 (= N900) binding
- K822 (= K917) binding
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
33% identity, 43% coverage: 26:441/960 of query aligns to 5:413/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ K56), C37 (= C58), D38 (≠ A59), G46 (= G67), C48 (= C69), R49 (= R70), C51 (= C72), A63 (= A84), C65 (= C86)
- binding guanosine-5'-triphosphate: R320 (= R349)
- binding iron/sulfur cluster: H99 (= H118), D102 (= D121), C103 (= C122), C106 (= C125), G109 (≠ N128), C112 (= C131), Q115 (= Q134), C152 (= C173), V153 (≠ I174), L154 (≠ V175), C155 (= C176), A156 (≠ S177), R157 (= R178), C158 (= C179), C202 (= C226), P203 (= P227), V204 (≠ T228), A206 (≠ T230), L207 (= L231), C228 (= C250), C231 (= C253), S233 (≠ V255), C235 (= C257), N262 (≠ A284), C263 (= C285), G266 (= G288), P391 (= P420), I392 (≠ V421)
Sites not aligning to the query:
- binding guanosine-5'-triphosphate: 486, 487, 554, 556, 559, 579, 580, 582, 627, 689, 695, 696, 697
8a6tA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
41% identity, 22% coverage: 26:238/960 of query aligns to 4:211/571 of 8a6tA
- binding fe2/s2 (inorganic) cluster: C36 (= C58), D37 (≠ A59), C47 (= C69), R48 (= R70), C50 (= C72), C63 (= C86)
- binding iron/sulfur cluster: H95 (= H118), C99 (= C122), C102 (= C125), C108 (= C131), C146 (= C173), C149 (= C176), G150 (≠ S177), K151 (≠ R178), C152 (= C179), C156 (= C183), C189 (= C216), C192 (= C219), C195 (= C222), C199 (= C226), G202 (≠ A229)
Sites not aligning to the query:
- binding 2 iron/2 sulfur/5 carbonyl/2 water inorganic cluster: 229, 230, 231, 298, 323, 352, 353, 357, 412, 500
- binding iron/sulfur cluster: 299, 354, 496, 500
7b0nG 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
28% identity, 47% coverage: 25:477/960 of query aligns to 2:449/694 of 7b0nG
- binding fe2/s2 (inorganic) cluster: C35 (= C58), G44 (= G67), C46 (= C69), R47 (= R70), C49 (= C72), C63 (= C86)
- binding iron/sulfur cluster: H95 (= H118), C99 (= C122), C102 (= C125), C108 (= C131), Q111 (= Q134), C149 (= C173), H151 (≠ V175), C152 (= C176), T153 (≠ S177), C155 (= C179), C199 (= C226), V201 (≠ T228)
7zm7A Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
28% identity, 45% coverage: 25:456/960 of query aligns to 2:425/711 of 7zm7A
- binding fe2/s2 (inorganic) cluster: R33 (≠ K56), C35 (= C58), Y36 (≠ A59), G44 (= G67), C46 (= C69), R47 (= R70), C49 (= C72), C63 (= C86)
- binding iron/sulfur cluster: H95 (= H118), D98 (= D121), C99 (= C122), C102 (= C125), Q104 (≠ A127), G105 (≠ N128), C108 (= C131), Q111 (= Q134), C149 (= C173), I150 (= I174), C152 (= C176), T153 (≠ S177), C155 (= C179), I179 (≠ V203), C199 (= C226), V201 (≠ T228), L204 (= L231)
7arcG Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
28% identity, 47% coverage: 25:473/960 of query aligns to 5:426/682 of 7arcG
- binding fe2/s2 (inorganic) cluster: R36 (≠ K56), C38 (= C58), Y39 (≠ A59), G47 (= G67), C49 (= C69), R50 (= R70), C52 (= C72), C66 (= C86)
- binding iron/sulfur cluster: H98 (= H118), D101 (= D121), C102 (= C122), C105 (= C125), Q107 (≠ A127), C111 (= C131), Q114 (= Q134), C150 (= C173), I151 (= I174), C153 (= C176), C156 (= C179), C200 (= C226), V202 (≠ T228), A204 (≠ T230), L205 (= L231)
- binding : K272 (≠ H297), Q274 (≠ D299), R275 (= R300), N277 (≠ T302)
Sites not aligning to the query:
8a5eA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
37% identity, 24% coverage: 25:251/960 of query aligns to 3:231/583 of 8a5eA
- binding fe2/s2 (inorganic) cluster: T34 (≠ K56), C36 (= C58), G45 (= G67), C47 (= C69), C50 (= C72), C64 (= C86)
- binding iron/sulfur cluster: H96 (= H118), N97 (≠ P119), C100 (= C122), C103 (= C125), S106 (≠ N128), C109 (= C131), C148 (= C173), C151 (= C176), K152 (≠ S177), C154 (= C179), C158 (= C183), V166 (≠ A191), C191 (= C216), C194 (= C219), G195 (= G220), C197 (= C222), C201 (= C226), P202 (= P227), V203 (≠ T228)
Sites not aligning to the query:
Query Sequence
>PP_2185 FitnessBrowser__Putida:PP_2185
MINFFDPASDKSSDLGTPARESDVQVSLSIDGRAISVPAGTSVMRAAAMLGTSIPKLCAT
DSLEAFGSCRMCMVEIEGMRGYPASCTTPVSEGMVVRTETPRLAGLRRNVMELYISDHPL
DCLTCSANGNCELQTVAGQVGLREVRYGYDGANHLDEKKDVSNPYFDYEPSKCIVCSRCV
RACEDIQGTFALTITGRGFESRVAAAGGENFLASECVSCGACVQTCPTATLTEKSLVQLG
QPERSVITTCAYCGVGCSFRAEIKGDQLVRMVPDKNGGANHGHACVKGRFAWGYATHPDR
ITKPMIRKRLEDPWQEVSWDEAVTYAASEFRRIQLKYGRDSIGGITSSRCTNEEAYLVQK
LVRTAFGNNNVDTCARVCHSPTGYGLKQTLGESAGTQSFDSVMQADVVLVIGANPTDAHP
VFGSQLKRRLRQGARLIVIDPRRIDLVDSPHARADLHLQLRPGTNVAMLNALAHVIVTEG
LLAQSFIDARCETGDFARWRDFVSLPDNAPEVLGPVCGVPAEQIRAAARLYATGGNAAIY
YGLGVTEHSQGSTAVMGIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSFPHELPGY
RHVSNEGVRAEFEQAWGVTLQPDPGLRIPNMFEAALDGSFKALYCQGEDIAQSDPNTQHV
TAALLAMECVVVQDIFLNETAKFAHVFLPGSSFLEKDGTFTNAERRISRVRKVMEPLAGK
ADWEATVALANALGYPMNYRHPSEIMDEIARLTPTFRRISYAELDRHGSLQWPCNDAAPD
GTPTMHIDQFVRGKGRFMLTGYVPTDEKVNNRYPLLLTTGRILSQYNVGAQTRRTGNVAW
HDADRLEIHPTDAESRGIQDGDWVGIGSRAGQTVLRAKVSTRVAPGVVYTTFHFPESGAN
VITTDNSDWATNCPEYKVTAVEVVKVFQPSQWQKRYQDFSDEQQRLLKERRTAEKAEVRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory