Comparing PP_2196 FitnessBrowser__Putida:PP_2196 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
61% identity, 98% coverage: 1:304/311 of query aligns to 14:318/323 of 4dz4B
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
56% identity, 87% coverage: 34:304/311 of query aligns to 34:303/306 of P60651
7lbaB E. Coli agmatinase (see paper)
56% identity, 87% coverage: 34:304/311 of query aligns to 41:310/310 of 7lbaB
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
56% identity, 87% coverage: 34:304/311 of query aligns to 24:293/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
54% identity, 87% coverage: 34:304/311 of query aligns to 20:283/284 of 7loxA
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
43% identity, 92% coverage: 15:300/311 of query aligns to 14:309/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
43% identity, 92% coverage: 15:300/311 of query aligns to 17:312/319 of Q9I3S3
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
41% identity, 94% coverage: 15:306/311 of query aligns to 12:310/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
41% identity, 94% coverage: 15:305/311 of query aligns to 4:301/301 of 1gq6B
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
41% identity, 93% coverage: 15:302/311 of query aligns to 14:308/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
41% identity, 93% coverage: 15:302/311 of query aligns to 15:309/316 of 3nipB
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
41% identity, 93% coverage: 15:302/311 of query aligns to 17:311/318 of Q9I6K2
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
33% identity, 95% coverage: 15:311/311 of query aligns to 54:359/378 of 7esrA
Q57757 Agmatinase; EC 3.5.3.11 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
31% identity, 85% coverage: 36:300/311 of query aligns to 24:282/284 of Q57757
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
29% identity, 86% coverage: 34:300/311 of query aligns to 6:269/276 of 3lhlA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
33% identity, 93% coverage: 11:299/311 of query aligns to 3:296/303 of 1wogA
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
28% identity, 87% coverage: 36:306/311 of query aligns to 26:287/293 of 3pzlB
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 83% coverage: 39:297/311 of query aligns to 69:336/342 of P46637
Sites not aligning to the query:
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
30% identity, 83% coverage: 39:297/311 of query aligns to 45:312/318 of 6vsuE
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
29% identity, 94% coverage: 5:297/311 of query aligns to 23:332/338 of G7JFU5
>PP_2196 FitnessBrowser__Putida:PP_2196
MTRDSLYGTAAESTYAGVVSFSRRRYSRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIR
AASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQSVPDSIEAHAEHILQAGCAMLT
LGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEAGKRIDHGTMFWHAAREGLVDPA
HSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYA
PGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCL
YAARHKVDNGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory