Comparing PP_2198 PP_2198 aldose sugar dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
7cdyA Crystal structure of glucose dehydrogenase
69% identity, 90% coverage: 36:378/381 of query aligns to 2:344/346 of 7cdyA
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
60% identity, 95% coverage: 15:377/381 of query aligns to 8:367/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
62% identity, 90% coverage: 34:377/381 of query aligns to 2:345/348 of 2g8sA
7cgzA Glucose dehydrogenase
63% identity, 90% coverage: 36:378/381 of query aligns to 2:319/321 of 7cgzA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
38% identity, 89% coverage: 35:372/381 of query aligns to 2:318/333 of 2ismB
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
35% identity, 88% coverage: 37:372/381 of query aligns to 6:319/338 of 3a9hA
Sites not aligning to the query:
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
35% identity, 88% coverage: 37:372/381 of query aligns to 6:319/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
33% identity, 90% coverage: 29:372/381 of query aligns to 3:317/334 of 3dasA
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
27% identity, 97% coverage: 1:368/381 of query aligns to 11:448/478 of P13650
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
27% identity, 86% coverage: 40:368/381 of query aligns to 22:424/453 of 5minB
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
26% identity, 86% coverage: 40:368/381 of query aligns to 22:422/448 of 1cruA
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
27% identity, 86% coverage: 40:368/381 of query aligns to 22:418/444 of 1cq1A
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
27% identity, 86% coverage: 40:368/381 of query aligns to 22:418/444 of 1c9uA
7pgmB Hhip-c in complex with heparin (see paper)
25% identity, 50% coverage: 34:222/381 of query aligns to 3:203/427 of 7pgmB
Sites not aligning to the query:
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
24% identity, 50% coverage: 34:222/381 of query aligns to 3:208/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
24% identity, 50% coverage: 31:222/381 of query aligns to 1:209/437 of 7pgnA
Sites not aligning to the query:
Q96QV1 Hedgehog-interacting protein; HHIP; HIP from Homo sapiens (Human) (see 3 papers)
24% identity, 50% coverage: 31:222/381 of query aligns to 213:428/700 of Q96QV1
Sites not aligning to the query:
>PP_2198 PP_2198 aldose sugar dehydrogenase
MLRAHWLATLTAAALLPLWAHAAAEQRFPSEEGTLIVDTLADGLRNPWALAFLPGGKDML
VTERAGNLRLVNAEGKVGPSISGVPKVWAEGQGGLLDVALSPEFGKDRTVYLSYAEEGSD
GKAGTAVGRGQLSEDRARLENFTVIFRQQPKLSVGNHFGSRLVFDRDGYLFIALGENNQR
PTAQDLDKLQGKVVRILPDGEVPKDNPFVGKDNVRPEIWSYGHRNQQGAALNPWTGQLWT
HEHGPRGGDEINIPKPGKNYGWPIATHGINYSLLPIPEAKGEHVDGMVDPHHVWEKSPGI
SGMAFYDSPTFKAWDHNLFIGALATQELIRLQLDGDKVVHEERLLGDLKARIRDVRVGPD
GYLYVLTDDKDGALLKVGLAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory