Comparing PP_2247 FitnessBrowser__Putida:PP_2247 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
40% identity, 86% coverage: 15:122/125 of query aligns to 15:123/124 of 7cd4A
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
43% identity, 86% coverage: 15:121/125 of query aligns to 15:121/126 of 2b33B
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
39% identity, 86% coverage: 15:122/125 of query aligns to 17:127/127 of 5v4dA
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
35% identity, 94% coverage: 4:121/125 of query aligns to 5:123/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
35% identity, 94% coverage: 4:121/125 of query aligns to 5:123/127 of 2uykC
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 82% coverage: 15:117/125 of query aligns to 78:182/187 of Q94JQ4
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
34% identity, 82% coverage: 15:117/125 of query aligns to 15:118/124 of 3k0tC
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
39% identity, 87% coverage: 15:123/125 of query aligns to 20:130/137 of P80601
Sites not aligning to the query:
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
35% identity, 98% coverage: 1:123/125 of query aligns to 1:130/137 of P52759
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
38% identity, 81% coverage: 17:117/125 of query aligns to 1:103/108 of 5hp8A
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
37% identity, 82% coverage: 15:117/125 of query aligns to 18:122/128 of A0A1J1DL12
Sites not aligning to the query:
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 86% coverage: 15:121/125 of query aligns to 16:124/128 of Q7CP78
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
34% identity, 86% coverage: 15:121/125 of query aligns to 15:124/127 of 3vczB
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
28% identity, 79% coverage: 10:108/125 of query aligns to 11:111/128 of P0AFQ5
3lybB Structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae
27% identity, 82% coverage: 21:122/125 of query aligns to 6:134/137 of 3lybB
>PP_2247 FitnessBrowser__Putida:PP_2247
MSNDIQRFPSSLPFPFSRAVKAGGFLFLSGQVPMSAGGEVVRGDIQTQTRAACERIAESL
AACGARFDQVVKVTVWLSDMRHFAGFNEVYKAFFGAALPVRSTVASALALGVDVEIEVQA
FVGDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory