Comparing PP_2372 FitnessBrowser__Putida:PP_2372 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
24% identity, 76% coverage: 31:301/358 of query aligns to 8:264/302 of 5ocpA
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
22% identity, 82% coverage: 31:323/358 of query aligns to 10:287/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
22% identity, 82% coverage: 31:323/358 of query aligns to 9:286/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
22% identity, 82% coverage: 31:323/358 of query aligns to 9:286/304 of 6hbmA
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
26% identity, 31% coverage: 161:270/358 of query aligns to 127:239/296 of 2vk2A
Sites not aligning to the query:
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
26% identity, 31% coverage: 161:270/358 of query aligns to 149:261/318 of P39325
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
22% identity, 49% coverage: 97:270/358 of query aligns to 75:236/292 of 2fn8A
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
23% identity, 43% coverage: 137:291/358 of query aligns to 100:249/274 of 2ioyA
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
24% identity, 49% coverage: 84:260/358 of query aligns to 60:220/301 of 2x7xA
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
25% identity, 59% coverage: 35:246/358 of query aligns to 14:209/315 of 4rsmA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 59% coverage: 35:246/358 of query aligns to 46:241/349 of A0QYB5
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
26% identity, 38% coverage: 136:272/358 of query aligns to 110:242/288 of 1rpjA
Sites not aligning to the query:
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
26% identity, 38% coverage: 136:272/358 of query aligns to 110:242/288 of 1gudA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
24% identity, 51% coverage: 95:277/358 of query aligns to 49:231/287 of 5ibqA
Sites not aligning to the query:
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
24% identity, 51% coverage: 95:277/358 of query aligns to 49:231/287 of 4ry0A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
27% identity, 49% coverage: 73:246/358 of query aligns to 92:241/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
27% identity, 49% coverage: 73:246/358 of query aligns to 59:208/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
27% identity, 49% coverage: 73:246/358 of query aligns to 59:208/315 of 4rs3A
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
22% identity, 66% coverage: 36:272/358 of query aligns to 15:242/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
22% identity, 66% coverage: 36:272/358 of query aligns to 15:242/288 of 8wl9A
Sites not aligning to the query:
>PP_2372 FitnessBrowser__Putida:PP_2372
MLKALCQSLCLVLPLVANAQPASVVFLNPGLSTETFWTSYTRFMQAAADELGMTLQVQYS
ERRADLTLTQARAILSAPQRPDYLVLVNEQYVAPEILRLSRGTGVKLLLVNNGLTASQRL
SIEGQPDKYAEPLGTLMSNDEQAGFQMLHLMLAQLPRDAGPVDLVAFAGVKTTPASQLRV
EGMRRALADFPQVRLRQVVYGGWNRQRAYEQAKQLLERYPATRLVWSANDQMAFGAMQAF
EEAGHTPGRDVLFAAVNSSPEALRARIDGRLSVLMGGHFTLGGWAMVMLHDDAHGLALNR
DGVRERRIPVLQEIDQAKARRWLKLLERDDYGVDFRRYSAEGRPPGYRYPFLASPVEY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory