Comparing PP_2411 FitnessBrowser__Putida:PP_2411 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 82% coverage: 76:442/445 of query aligns to 63:444/446 of A0A0H2VG78
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 65% coverage: 14:304/445 of query aligns to 39:315/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 68% coverage: 70:373/445 of query aligns to 117:487/587 of P25297
Sites not aligning to the query:
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 53% coverage: 182:419/445 of query aligns to 164:418/430 of P0AA76
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
26% identity, 53% coverage: 182:419/445 of query aligns to 153:399/409 of 6e9nA
Sites not aligning to the query:
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
30% identity, 36% coverage: 71:232/445 of query aligns to 66:206/403 of P77589
Sites not aligning to the query:
>PP_2411 FitnessBrowser__Putida:PP_2411
MSAHHEVSPATLRRVIAASAIGNFVEWFDFAVYGFLATLIASQFFASEDASVALLKTFAV
FAVAFALRPLGGIVFGALGDRLGRKRILSLTILLMAGSTTLIGLLPTYASIGLAAPALLT
LARCLQGFSAGGEYAGACAYLMEHAPDDKRAFYGSFVPVSTFSAFACAAVIAYGLEASLS
TEAMNAWGWRIPFLIAAPLGLVGLYLRWRMEETPAFREAVAQGKEHEHSPLKETLRHHGR
VIRNLGAFISLTALSFYMFTTYFATYLQLVGNLTRAQSLLVTTVALLFAAVGCPLAGAFS
DRVGRRKTIGFTCLWVMLCVFPAYWLASSGSMSGALLGVILLAVGALCSGVVTAALLSES
FPTRTRYTASAITYNVAYTLFGGTAPLVATWLIAQTGSSLAPAFYLVVIALVALVGGLAL
PETSRISLHDDLGVDGVRAGARRAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory