Comparing PP_2416 FitnessBrowser__Putida:PP_2416 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 94% coverage: 12:256/262 of query aligns to 12:261/265 of P07821
5x40A Structure of a cbio dimer bound with amppcp (see paper)
38% identity, 92% coverage: 10:249/262 of query aligns to 3:246/280 of 5x40A
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
29% identity, 86% coverage: 6:230/262 of query aligns to 1:216/353 of 1vciA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 79% coverage: 25:230/262 of query aligns to 20:230/375 of 2d62A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/238 of 6s8gA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/233 of 6b8bA
1g291 Malk (see paper)
34% identity, 79% coverage: 25:230/262 of query aligns to 17:227/372 of 1g291
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 87% coverage: 12:240/262 of query aligns to 3:233/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
28% identity, 87% coverage: 12:240/262 of query aligns to 4:234/241 of 6mbnA
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
32% identity, 79% coverage: 27:232/262 of query aligns to 20:226/276 of Q5M243
7qkrA Cryo-em structure of abc transporter ste6-2p from pichia pastoris with verapamil at 3.2 a resolution (see paper)
34% identity, 79% coverage: 25:231/262 of query aligns to 378:595/1199 of 7qkrA
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 77% coverage: 27:227/262 of query aligns to 21:225/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 77% coverage: 27:227/262 of query aligns to 21:225/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
33% identity, 77% coverage: 27:227/262 of query aligns to 21:225/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 77% coverage: 27:227/262 of query aligns to 21:225/353 of Q97UY8
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 79% coverage: 23:230/262 of query aligns to 16:222/393 of P9WQI3
>PP_2416 FitnessBrowser__Putida:PP_2416
MTAMAAVRIPPLACHGLGLQLAGNTVLSDIDLRVVAGETLGIVGPNGSGKSSLLKLLAGL
RKPACGSVQLLGEPLAQMPRRRVAQALALVEQQADTLDAISVFDAVALGRTPWLSALAPF
SRQDCAIVEQALADLDALHLRTRLWGSLSGGERQRVHIARALAQRPQVLLLDEPTNHLDI
QHQLSLLQQVQALPVTTLVALHDLNQALTCDRVAVLDKGRLVALGNPFEVLTPERLLSTF
GVHAHYLTDPFDGARILRFRAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory