SitesBLAST
Comparing PP_2443 FitnessBrowser__Putida:PP_2443 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
27% identity, 96% coverage: 16:400/403 of query aligns to 15:418/425 of O59010
- S65 (≠ I59) mutation to V: Strongly decreased chloride conductance.
- R276 (= R260) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 260:262) binding
- M311 (= M295) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A298) binding
- V355 (= V339) binding
- D394 (= D376) binding
- M395 (≠ S377) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ E379) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N383) binding
- D405 (= D387) mutation to N: Strongly decreased affinity for aspartate.
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 95% coverage: 16:398/403 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S262), M303 (= M295), T306 (≠ A298), A345 (≠ S337), G346 (= G338), V347 (= V339), G351 (≠ S343), D386 (= D376), C389 (≠ E379), T390 (= T380), N393 (= N383)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
27% identity, 95% coverage: 16:398/403 of query aligns to 7:408/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 95% coverage: 16:398/403 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 95% coverage: 16:398/403 of query aligns to 15:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L41), F46 (≠ L41), P75 (≠ N67), L91 (= L84), F95 (= F88), L130 (= L124), I133 (≠ L127), I159 (= I152), Y167 (vs. gap), K196 (≠ L178), G200 (≠ V182), I207 (≠ L189), F210 (= F192), L250 (= L231), I262 (≠ L247), M269 (≠ G253), T334 (≠ D318), V335 (≠ L319), G336 (≠ P320), T340 (≠ L324), L343 (≠ V327), M399 (≠ A381)
- binding aspartic acid: S277 (= S261), S278 (= S262), T314 (≠ A298), G354 (= G338), A358 (≠ G342), G359 (≠ S343), D394 (= D376), R397 (≠ E379), T398 (= T380)
- binding sodium ion: Y89 (≠ L82), T92 (≠ L85), S93 (≠ G86), G306 (= G290), T308 (= T292), N310 (= N294), N310 (= N294), M311 (= M295), D312 (≠ A296), S349 (≠ A333), I350 (≠ C334), T352 (≠ A336), N401 (= N383), V402 (≠ S384), D405 (= D387)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 95% coverage: 16:398/403 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (vs. gap), V83 (≠ I79), I157 (≠ G153), Y164 (vs. gap), K193 (≠ L178), T305 (= T292), I306 (= I293), I347 (≠ C334)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I17), M199 (≠ I184), S275 (= S262), T311 (≠ A298), G356 (≠ S343), L384 (≠ I371), D391 (= D376), R394 (≠ E379)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 74% coverage: 16:314/403 of query aligns to 7:322/396 of 6bmiA
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 96% coverage: 16:400/403 of query aligns to 13:418/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
26% identity, 96% coverage: 16:400/403 of query aligns to 10:415/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (= L178), G195 (≠ V182), R282 (≠ A271)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R260), S272 (= S261), S273 (= S262), M307 (= M295), T310 (≠ A298), G353 (= G341), A354 (≠ G342), R394 (≠ E379), T395 (= T380)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 96% coverage: 16:400/403 of query aligns to 11:416/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
26% identity, 96% coverage: 16:400/403 of query aligns to 6:407/416 of 6r7rA
- binding d-aspartic acid: R263 (= R260), S265 (= S262), M299 (= M295), T302 (≠ A298), T340 (≠ A336), G342 (= G338), V343 (= V339), G347 (≠ S343), D383 (= D376), R386 (≠ E379), T387 (= T380), N390 (= N383)
- binding decyl-beta-d-maltopyranoside: H23 (vs. gap), V212 (≠ L208), A216 (≠ H212)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 96% coverage: 16:400/403 of query aligns to 13:418/427 of 5e9sA
- binding aspartic acid: R274 (= R260), S275 (= S261), S276 (= S262), T313 (≠ A298), G353 (= G338), V354 (= V339), A357 (≠ G342), G358 (≠ S343), D394 (= D376), R397 (≠ E379), T398 (= T380)
- binding decyl-beta-d-maltopyranoside: L194 (= L178), G198 (≠ V182), Y202 (≠ F186)
- binding sodium ion: Y87 (≠ L84), T90 (= T87), S91 (≠ F88), S276 (= S262), G305 (= G290), A306 (= A291), T307 (= T292), N309 (= N294), N309 (= N294), M310 (= M295), D311 (≠ A296), S348 (≠ A333), I349 (≠ C334), G350 (= G335), T351 (≠ A336), N401 (= N383), V402 (≠ S384), D405 (= D387)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
27% identity, 65% coverage: 124:383/403 of query aligns to 185:445/503 of Q10901
- N187 (= N126) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 177 modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
25% identity, 61% coverage: 143:389/403 of query aligns to 154:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: M163 (≠ I152), F167 (≠ V156), F293 (≠ V285), V297 (≠ L289)
- binding aspartic acid: S268 (= S261), S269 (= S262), T306 (≠ A298), G346 (= G338), I347 (≠ V339), A350 (≠ G342), G351 (≠ S343), D380 (= D376), R383 (≠ E379), T384 (= T380)
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 61% coverage: 143:387/403 of query aligns to 240:485/573 of P31596
- K298 (≠ S197) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ F223) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
28% identity, 61% coverage: 143:387/403 of query aligns to 240:485/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 61% coverage: 143:389/403 of query aligns to 147:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: M156 (≠ I152), F160 (≠ V156), F286 (≠ V285), V290 (≠ L289)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I148 (≠ F144), S262 (= S262), S263 (≠ A263), A292 (= A291), T293 (= T292), M296 (= M295), T299 (≠ A298), G329 (= G335), A336 (≠ G342), G337 (≠ S343), D366 (= D376), R369 (≠ E379), N373 (= N383)
Sites not aligning to the query:
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
24% identity, 60% coverage: 135:375/403 of query aligns to 233:479/543 of P56564
Sites not aligning to the query:
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 216 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
29% identity, 61% coverage: 143:389/403 of query aligns to 222:469/532 of P43007
- E256 (≠ N174) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ S377) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
Sites not aligning to the query:
- 201 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
23% identity, 60% coverage: 135:375/403 of query aligns to 233:479/542 of P43003
- S363 (≠ R260) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ RSS 260:262) binding
- T396 (= T292) binding
- T402 (≠ A298) binding
- IPQAG 443:447 (≠ VAGGS 339:343) binding
- D476 (≠ G372) binding
- R477 (≠ V373) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
Sites not aligning to the query:
- 483 binding
- 523 Y→F: No effect on activity.
Query Sequence
>PP_2443 FitnessBrowser__Putida:PP_2443
MTPFLRILNRTSLVTQIVIGLLAGIALALLAPAIARDLAFLGKVFVSALKAVAPVLVFIL
VMASVANHRHGQETHIRPILWLYLLGTFAAAVVAVFASMLFPSHLALSTSEATLSAPGGI
AEVLQNLLLNAVDNPVNALLNANFIGVLTWAIGLGVALRHAGETTRTVVEDLSNGVTLIV
RVVIRFAPLGIFGLVSSTLAQSGLDALLGYLHLLAVLIGCMLFVALVMNPLIVFWKIRRN
PYPLTLLCLRESGITAFFTRSSAANIPVNLALSERLGLHEDTYSVSIPLGATINMAGAAI
TITVLTLAAVHTLGIQVDLPTAVLLSVVAAVCACGASGVAGGSLLLIPLACSLFGIPSEI
AMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACQAQEQRHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory