Comparing PP_2453 FitnessBrowser__Putida:PP_2453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wywA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-asp at ph 4.5
96% identity, 91% coverage: 34:362/362 of query aligns to 1:317/317 of 6wywA
6wyyA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-glu at ph 6.5
95% identity, 91% coverage: 33:362/362 of query aligns to 1:315/315 of 6wyyA
6wyzA Crystal structure of pseudomonas 7a glutaminase-asparaginase (mutant k173m) in complex with d-glu at ph 5.5
95% identity, 91% coverage: 34:362/362 of query aligns to 1:312/312 of 6wyzA
4pgaA Glutaminase-asparaginase from pseudomonas 7a (see paper)
95% identity, 91% coverage: 33:362/362 of query aligns to 1:330/330 of 4pgaA
1djpA Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor don covalently bound in the active site (see paper)
95% identity, 91% coverage: 33:362/362 of query aligns to 1:330/330 of 1djpA
1djoA Crystal structure of pseudomonas 7a glutaminase-asparaginase with the inhibitor donv covalently bound in the active site (see paper)
95% identity, 91% coverage: 33:362/362 of query aligns to 1:330/330 of 1djoA
P10182 Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; PGA; EC 3.5.1.38 from Pseudomonas sp. (strain ATCC 29598 / 7A) (see paper)
92% identity, 93% coverage: 26:362/362 of query aligns to 1:337/337 of P10182
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
49% identity, 90% coverage: 37:362/362 of query aligns to 4:328/328 of 5k45A
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
49% identity, 90% coverage: 37:362/362 of query aligns to 4:328/328 of 5k3oA
P06608 L-asparaginase; L-ASNase; L-asparagine amidohydrolase; EC 3.5.1.1 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 2 papers)
46% identity, 93% coverage: 28:362/362 of query aligns to 19:348/348 of P06608
1hg0A X-ray structure of the complex between erwinia chrysanthemi l- asparaginase and succinic acid (see paper)
46% identity, 91% coverage: 33:362/362 of query aligns to 3:327/327 of 1hg0A
1jsrA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-l-norleucine (see paper)
46% identity, 91% coverage: 34:362/362 of query aligns to 1:324/324 of 1jsrA
1jslA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-d-norleucine (see paper)
46% identity, 91% coverage: 34:362/362 of query aligns to 1:324/324 of 1jslA
7u6mC Albumin binding domain fused to a mutant of the erwinia asparaginase (see paper)
46% identity, 92% coverage: 29:362/362 of query aligns to 14:342/342 of 7u6mC
2gvnA L-asparaginase from erwinia carotovora in complex with aspartic acid (see paper)
47% identity, 91% coverage: 34:362/362 of query aligns to 2:325/325 of 2gvnA
P00805 L-asparaginase 2; L-asparaginase II; L-ASNase II; L-asparagine amidohydrolase II; Colaspase; EC 3.5.1.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 99% coverage: 5:362/362 of query aligns to 1:348/348 of P00805
7r5qA Escherichia coli type ii asparaginase n24s mutant in complex with glu (see paper)
45% identity, 91% coverage: 34:362/362 of query aligns to 1:306/306 of 7r5qA
1ho3A Crystal structure analysis of e. Coli l-asparaginase ii (y25f mutant) (see paper)
47% identity, 91% coverage: 34:362/362 of query aligns to 1:326/326 of 1ho3A
1jazA Crystal structure of monoclinic form of d90e mutant of escherichia coli asparaginase ii (see paper)
44% identity, 91% coverage: 34:362/362 of query aligns to 1:307/307 of 1jazA
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
44% identity, 91% coverage: 34:362/362 of query aligns to 1:326/326 of 2wltA
>PP_2453 FitnessBrowser__Putida:PP_2453
MNAALKTFAPSALALLLILPSSASAKEAETQQKLANVVILATGGTIAGAGASAANSATYQ
AAKLGVDKLIAGVPELADIANVRGEQVMQIASESISNDDLLKLGKRVAELAESKDVDGIV
ITHGTDTLEETAFFLNLVEKTDKPIVVVGSMRPGTAMSADGMLNLYNAVAVASDKQSRGK
GVLVTMNDEIQSGRDVSKAVNIKTEAFKSAWGPMGMVVEGKSYWFRLPAKRHTVNSEFDI
KQISSLPQVDIAYGYGNVTDTAYKALAQNGAKALIHAGTGNGSVSSRVVPALQELRKNGV
QIIRSSHVNQGGFVLRNAEQPDDKNDWVVAHDLNPQKARILAMVAMTKTQDSKELQRIFW
EY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory