Comparing PP_2455 PP_2455 ribose ABC transporter - ATP-binding subunit to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 94% coverage: 14:504/524 of query aligns to 2:491/501 of P04983
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 13:233/524 of query aligns to 2:226/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 42% coverage: 13:233/524 of query aligns to 1:225/229 of 7v8iD
7mdyC Lolcde nucleotide-bound
32% identity, 42% coverage: 15:233/524 of query aligns to 1:223/226 of 7mdyC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 39% coverage: 30:231/524 of query aligns to 16:215/240 of 4ymuJ
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 41% coverage: 15:231/524 of query aligns to 1:221/222 of 7arlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
32% identity, 39% coverage: 30:233/524 of query aligns to 22:223/226 of 5xu1B
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
29% identity, 39% coverage: 30:235/524 of query aligns to 23:226/650 of 5ws4A
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
32% identity, 40% coverage: 22:233/524 of query aligns to 7:218/222 of 8i6rB
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
33% identity, 38% coverage: 34:230/524 of query aligns to 21:215/219 of 8w6iD
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
33% identity, 38% coverage: 34:230/524 of query aligns to 21:215/222 of P0A9R7
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 31:255/524 of query aligns to 21:243/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 31:255/524 of query aligns to 21:243/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 43% coverage: 31:255/524 of query aligns to 21:243/353 of 1oxuA
Sites not aligning to the query:
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 43% coverage: 31:255/524 of query aligns to 21:243/353 of Q97UY8
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
32% identity, 38% coverage: 34:230/524 of query aligns to 21:215/218 of 8hd0A
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 45% coverage: 30:264/524 of query aligns to 23:250/648 of P75831
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 40% coverage: 20:231/524 of query aligns to 5:220/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 40% coverage: 20:231/524 of query aligns to 6:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 40% coverage: 20:231/524 of query aligns to 6:221/344 of 3tuiC
>PP_2455 PP_2455 ribose ABC transporter - ATP-binding subunit
MLPGESAMPALANEVVLAASGLGKTYAQPVLGEVSLSLRAGEVLALTGENGAGKSTLSKL
ISGLEVPTTGHMTYRGQAYAPGSRGEAERLGVRMVMQELNLLPTLTVAENLFLDNLPSRF
GWISHKRLRQLATAAMARVGLDAIDPDTPVGELGIGHQQMVEIARNLIGDCHVLILDEPT
AMLTAREVALLFTQIERLRARGVAIVYISHRLEELQRVAQRIVVLRDGKLVCDEPIQRYS
SAELVNLMVGRELGEHIDLGRRQLGAPLLKVDKLCRGDKVREVSFEVRAGEIFGISGLIG
AGRTELLRLIYGADRADSGGIALGQPPQAVSIDSPKAAVRAGIALITEDRKGEGLLLTQS
ISANIALGNLGAVSRAGVLDSEAEKALAERQIQAMRIRSAGAQQVVGELSGGNQQKVVIG
RWLERDCQVLLFDEPTRGIDVGAKFDIYGLLAELARQGKALVVVSSDLRELMLICDRIAV
LSAGRLIDTFARDHWSQDQLLAAAFAGYQKRDALLHDAAPRMDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory