SitesBLAST
Comparing PP_2458 FitnessBrowser__Putida:PP_2458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
44% identity, 98% coverage: 5:300/302 of query aligns to 2:294/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N186), T217 (= T222), G219 (= G224), A220 (= A225), G222 (= G227), F250 (= F256), N272 (≠ Q278), G275 (≠ A281), A276 (= A282), T279 (≠ V285)
- binding magnesium ion: D242 (= D248), T244 (= T250), A278 (≠ S284), S287 (= S293)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
43% identity, 99% coverage: 1:300/302 of query aligns to 1:298/306 of 4xckA
- active site: A249 (= A251), A250 (= A252), G251 (= G253), D252 (= D254)
- binding adenosine-5'-diphosphate: T220 (= T222), G222 (= G224), S223 (≠ A225), V242 (= V244), T247 (= T249), A250 (= A252), F254 (= F256), H276 (≠ Q278), A279 (= A281), V283 (= V285)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G39 (= G40), K40 (= K41), N43 (= N44), A95 (= A96), I107 (= I108), I109 (= I110), E140 (= E141), T248 (= T250), D252 (= D254)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
39% identity, 99% coverage: 3:300/302 of query aligns to 3:304/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N186), T222 (= T222), G224 (= G224), A225 (= A225), G227 (= G227), T243 (≠ A241), V246 (= V244), A254 (= A252), G255 (= G253), N282 (≠ Q278), A285 (= A281), A286 (= A282), V289 (= V285)
- binding alpha-D-ribofuranose: D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), A96 (= A96), E141 (= E141), D256 (= D254)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
39% identity, 99% coverage: 3:300/302 of query aligns to 3:304/317 of 5c41A
- active site: G253 (≠ A251), A254 (= A252), G255 (= G253), D256 (= D254)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N186), T222 (= T222), G224 (= G224), A225 (= A225), G227 (= G227), V246 (= V244), G255 (= G253), N282 (≠ Q278), A285 (= A281), A286 (= A282)
5c3yA Structure of human ribokinase crystallized with amppnp
39% identity, 99% coverage: 3:300/302 of query aligns to 2:303/306 of 5c3yA
- active site: G252 (≠ A251), A253 (= A252), G254 (= G253), D255 (= D254)
- binding amp phosphoramidate: T221 (= T222), G223 (= G224), V245 (= V244), T250 (= T249), G254 (= G253), N281 (≠ Q278), A284 (= A281), A285 (= A282)
2fv7A Crystal structure of human ribokinase
39% identity, 99% coverage: 3:300/302 of query aligns to 2:303/308 of 2fv7A
- active site: G252 (≠ A251), A253 (= A252), G254 (= G253), D255 (= D254)
- binding adenosine-5'-diphosphate: N185 (= N186), T221 (= T222), G223 (= G224), G226 (= G227), T242 (≠ A241), V245 (= V244), A253 (= A252), G254 (= G253), N281 (≠ Q278), A284 (= A281), A285 (= A282), V288 (= V285)
6wjzA Crystal structure of human ribokinase in complex with ampcp
39% identity, 99% coverage: 3:300/302 of query aligns to 3:304/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N186), T222 (= T222), G224 (= G224), A225 (= A225), G227 (= G227), T243 (≠ A241), V246 (= V244), A254 (= A252), G255 (= G253), N282 (≠ Q278), A285 (= A281), A286 (= A282), V289 (= V285)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 98% coverage: 5:300/302 of query aligns to 7:301/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
41% identity, 98% coverage: 5:300/302 of query aligns to 6:300/307 of 1gqtB
- active site: A251 (= A251), A252 (= A252), G253 (= G253), D254 (= D254)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N186), T222 (= T222), G224 (= G224), S225 (≠ A225), A252 (= A252), G253 (= G253), H278 (≠ Q278), A281 (= A281)
- binding cesium ion: D248 (= D248), I250 (≠ T250), A284 (≠ S284), R287 (= R287), S293 (= S293)
- binding alpha-D-ribofuranose: N13 (= N12), D15 (= D14), G41 (= G40), N45 (= N44), E142 (= E141), D254 (= D254)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
41% identity, 98% coverage: 5:300/302 of query aligns to 4:298/305 of 1rk2A
- active site: A249 (= A251), A250 (= A252), G251 (= G253), D252 (= D254)
- binding adenosine-5'-diphosphate: T220 (= T222), G222 (= G224), S223 (≠ A225), A250 (= A252), G251 (= G253), H276 (≠ Q278), A279 (= A281)
- binding tetrafluoroaluminate ion: G213 (= G215), R215 (≠ G217)
- binding magnesium ion: D246 (= D248), A282 (≠ S284), R285 (= R287), S291 (= S293)
- binding alpha-D-ribofuranose: N11 (= N12), D13 (= D14), G38 (= G39), G39 (= G40), K40 (= K41), N43 (= N44), E140 (= E141), D252 (= D254)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
39% identity, 98% coverage: 5:300/302 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G224), A246 (= A225), T271 (= T249), A274 (= A252), G275 (= G253), N300 (≠ Q278), A303 (= A281)
- binding glycerol: D25 (= D14), S42 (≠ G31), S44 (= S33), G50 (= G39), G51 (= G40), N55 (= N44)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
39% identity, 98% coverage: 5:300/302 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G224), A246 (= A225), T271 (= T249), A274 (= A252), G275 (= G253), N300 (≠ Q278), A303 (= A281), V307 (= V285)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44), N157 (≠ L140), I159 (≠ V142), E190 (≠ D175)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
39% identity, 98% coverage: 5:300/302 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N186), T243 (= T222), G245 (= G224), A246 (= A225), G248 (= G227), T271 (= T249), G273 (≠ A251), A274 (= A252), G275 (= G253), N300 (≠ Q278), A303 (= A281), V307 (= V285)
- binding glycerol: D25 (= D14), G50 (= G39), G51 (= G40), N55 (= N44)
5byfA Crystal structure of human ribokinase in complex with amp
38% identity, 97% coverage: 9:300/302 of query aligns to 10:305/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
38% identity, 97% coverage: 9:300/302 of query aligns to 22:317/322 of Q9H477
6znxC Ribokinase from thermus species
42% identity, 98% coverage: 5:300/302 of query aligns to 2:259/265 of 6znxC
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
34% identity, 98% coverage: 1:295/302 of query aligns to 1:300/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N186), K225 (≠ T222), G227 (= G224), I246 (≠ A241), A248 (≠ H243), A257 (= A252), G258 (= G253), F261 (= F256), A286 (= A281), S287 (≠ A282)
- binding alpha-D-ribofuranose: N12 (= N12), D14 (= D14), G40 (= G40), K41 (= K41), N44 (= N44), E144 (= E141), D259 (= D254)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 96% coverage: 5:295/302 of query aligns to 71:366/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 100% coverage: 1:301/302 of query aligns to 4:304/319 of Q8ZKR2
- D16 (= D14) binding
- G31 (= G40) binding
- Y101 (≠ I108) binding
- R162 (≠ P173) binding
- A180 (≠ E191) binding
- A181 (= A192) binding
- A183 (≠ T194) binding
- G213 (= G215) binding
- D246 (= D248) binding
- T248 (= T250) binding
- D252 (= D254) binding
- A287 (≠ S284) binding
- A290 (≠ R287) binding
- G292 (= G289) binding
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
30% identity, 99% coverage: 4:301/302 of query aligns to 2:293/299 of 1tz3A
- active site: C24 (≠ V37), F88 (≠ N106), G238 (≠ A251), A239 (= A252), G240 (= G253), D241 (= D254)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ S10), S10 (≠ N12), D12 (= D14), G27 (= G40), L83 (≠ A96), F88 (≠ N106), Y90 (≠ I108), R151 (≠ P173), M154 (≠ W176), D241 (= D254)
Query Sequence
>PP_2458 FitnessBrowser__Putida:PP_2458
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPAMSSGVALITVDAASQNCIVIIPGANGLLTP
QSVRRFDALLQAAEVIICQLEVPASTVAWTLARGHELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVVVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APHVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory