Comparing PP_2478 FitnessBrowser__Putida:PP_2478 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
30% identity, 91% coverage: 62:722/730 of query aligns to 20:718/732 of 8gy3C
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
25% identity, 60% coverage: 204:639/730 of query aligns to 7:498/769 of O33819
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
25% identity, 58% coverage: 215:639/730 of query aligns to 10:490/761 of 1rm6A
Sites not aligning to the query:
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
22% identity, 48% coverage: 206:554/730 of query aligns to 12:401/786 of 1t3qB
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 33% coverage: 203:441/730 of query aligns to 2:272/420 of 3hrdE
Sites not aligning to the query:
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 33% coverage: 203:441/730 of query aligns to 2:272/420 of 3hrdA
Sites not aligning to the query:
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 33% coverage: 203:441/730 of query aligns to 3:273/425 of Q0QLF2
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 48% coverage: 203:555/730 of query aligns to 13:381/732 of P77489
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
33% identity, 17% coverage: 597:723/730 of query aligns to 608:743/748 of 5y6qC
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
24% identity, 48% coverage: 203:555/730 of query aligns to 13:381/731 of 5g5gC
Sites not aligning to the query:
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 48% coverage: 200:550/730 of query aligns to 590:967/1361 of Q8GUQ8
Sites not aligning to the query:
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
23% identity, 46% coverage: 222:554/730 of query aligns to 541:891/1262 of 3zyvB
Sites not aligning to the query:
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
23% identity, 46% coverage: 222:554/730 of query aligns to 594:947/1335 of G3X982
Sites not aligning to the query:
7dqxD Crystal structure of xanthine dehydrogenase family protein
23% identity, 36% coverage: 208:470/730 of query aligns to 6:313/770 of 7dqxD
Sites not aligning to the query:
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
21% identity, 36% coverage: 203:464/730 of query aligns to 11:324/804 of 1zxiB
Sites not aligning to the query:
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
21% identity, 36% coverage: 203:464/730 of query aligns to 12:325/805 of 1n63B
Sites not aligning to the query:
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
21% identity, 36% coverage: 203:464/730 of query aligns to 11:324/804 of 1n62B
Sites not aligning to the query:
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
21% identity, 36% coverage: 203:464/730 of query aligns to 11:324/804 of 1n5wB
Sites not aligning to the query:
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
21% identity, 36% coverage: 203:464/730 of query aligns to 10:323/803 of 1n60B
Sites not aligning to the query:
P19919 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
21% identity, 36% coverage: 203:464/730 of query aligns to 16:329/809 of P19919
Sites not aligning to the query:
>PP_2478 FitnessBrowser__Putida:PP_2478
MKKPNEVTVDMSRRRLLQGSGIALSGLVLSTWLPPLVAKSAAAEAAAAGRLGDHSAEGYG
AFVRIGPDGVVTVISPKIEMGQGAQTGIAMMVAEELEVPLDQVVIQEAPPNSALYTDSLM
QFQATGGSTSTRVTWEPLRRAGATARILLIQAAALQWRVAPSLCHAQNGQVFGPNGLQAA
YGDLVEAAATLPLPDAVPLKTPEQFKLLGTAAQRLDTPAKVNGKAHFTIDLQIPGMLVAS
SITCPVYGGRLLNVDDSQARRVPGVRDIVRLDNAVAVTASNFWTCQQAIRALKIEWDLGP
HAAIGSAQLDQELLVASSRDGVVAKRSGDIEQAKQQSASQFEAVYEQALLSHSPFEPMSC
VAHVRKDACELWVGTQVPVFAQQTAAQVTGLPVEKIQVHNQLIGGAFGRRLEFDFITQAV
AIARQVDYPIKLIWSREEDMTHDLYRPLYADRMQAALDEQGRPLGWEHRIAGASILARYV
GSLPPNGVDSDAVEVAVDPIYSLVHLQVRYIRQEPSVVPVSWWRGVGPLRGTYALECFID
ELAHNAKADPVAYRLELMAEQPRAQAVLRLLAEKTDWNKPLPAGQGRGVAVSAVFGSYVA
TLVELEMHGDLGIRIKRLVSVVDCGFATNPTSVKAQIEGGTLFGLSASLFNEILIENGQV
QQTNFHNYRQLRISEAPAVEVHLLPSLEAPGGVGEAGTALIGPALVNALYAASGQRIRRL
PLSRFGYYPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory