Comparing PP_2515 FitnessBrowser__Putida:PP_2515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
5cgzA Crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 (see paper)
100% identity, 93% coverage: 20:258/258 of query aligns to 2:240/240 of 5cgzA
8bgoG N,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose (see paper)
24% identity, 88% coverage: 20:247/258 of query aligns to 36:255/271 of 8bgoG
Q81ST8 N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1; GlcNAc-Mal deacetylase 1; EC 3.5.1.- from Bacillus anthracis (see paper)
25% identity, 89% coverage: 23:251/258 of query aligns to 7:222/234 of Q81ST8
5b2eA N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii complexed with its inhibitor mpg (acetate-containing condition) (see paper)
23% identity, 76% coverage: 20:215/258 of query aligns to 31:225/267 of 5b2eA
3wl3A N,n'-diacetylchitobiose deacetylase from pyrococcus horikoshii (see paper)
23% identity, 76% coverage: 20:215/258 of query aligns to 31:225/267 of 3wl3A
>PP_2515 FitnessBrowser__Putida:PP_2515
MTSCAHPHCRSQRNMNTPQKSALVVSAHSADFVWRAGGAIALHAEQGYAMHVVCLSFGER
GESAKLWRKGEMTEAKVKDARREEAMAAAEILGASVEFFDIGDYPMRADKDTLFRLADVY
RRVQPEFVLSHSLKDPYNYDHPLAMHLAQEARIIAQAEGYKPGEKIVGAPPVYAFEPHQP
EQCEWRPDTFLDITSVWDKKYAAIQCMAGQEHLWEYYTRVALQRGVQAKRNVGITSARNI
VYAEGLQSVFPRVTENLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory