Comparing PP_2554 FitnessBrowser__Putida:PP_2554 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
100% identity, 100% coverage: 1:635/635 of query aligns to 1:635/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
99% identity, 99% coverage: 1:627/635 of query aligns to 3:624/624 of 5hmqD
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
32% identity, 52% coverage: 295:624/635 of query aligns to 9:343/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
33% identity, 52% coverage: 295:624/635 of query aligns to 12:339/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
33% identity, 52% coverage: 295:624/635 of query aligns to 11:335/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
33% identity, 50% coverage: 295:614/635 of query aligns to 11:313/320 of 7xntC
Sites not aligning to the query:
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
31% identity, 50% coverage: 313:632/635 of query aligns to 22:357/357 of O52791
2r5vA Hydroxymandelate synthase crystal structure (see paper)
29% identity, 50% coverage: 313:628/635 of query aligns to 21:346/346 of 2r5vA
7yvvA Acmp1, r-4-hydroxymandelate synthase
27% identity, 53% coverage: 291:626/635 of query aligns to 1:334/335 of 7yvvA
1t47A Structure of fe2-hppd bound to ntbc (see paper)
31% identity, 29% coverage: 438:624/635 of query aligns to 167:358/362 of 1t47A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
27% identity, 48% coverage: 324:626/635 of query aligns to 40:342/343 of 3zgjB
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
26% identity, 28% coverage: 437:614/635 of query aligns to 177:363/393 of Q02110
Sites not aligning to the query:
7x5wA Crystal structure of athppd-y18022 complex
27% identity, 43% coverage: 334:603/635 of query aligns to 73:350/381 of 7x5wA
Sites not aligning to the query:
6isdA Crystal structure of arabidopsis thaliana hppd complexed with sulcotrione (see paper)
28% identity, 43% coverage: 333:603/635 of query aligns to 60:340/369 of 6isdA
Sites not aligning to the query:
1tfzA Structural basis for herbicidal inhibitor selectivity revealed by comparison of crystal structures of plant and mammalian 4- hydroxyphenylpyruvate dioxygenases (see paper)
27% identity, 43% coverage: 334:603/635 of query aligns to 72:342/364 of 1tfzA
Sites not aligning to the query:
5ywkA Crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl (see paper)
28% identity, 43% coverage: 333:603/635 of query aligns to 61:344/372 of 5ywkA
Sites not aligning to the query:
5ywgA Crystal structure of arabidopsis thaliana hppd complexed with mesotrione (see paper)
28% identity, 43% coverage: 333:603/635 of query aligns to 61:338/366 of 5ywgA
Sites not aligning to the query:
7x8hA Crystal structure of athppd-(+)-usnic acid complex (see paper)
28% identity, 43% coverage: 334:603/635 of query aligns to 73:351/386 of 7x8hA
Sites not aligning to the query:
8h6bA Crystal structure of athppd complexed with yh20702
28% identity, 43% coverage: 334:603/635 of query aligns to 73:351/382 of 8h6bA
Sites not aligning to the query:
8hxgA Crystal structure of athppd-y14116 complex
28% identity, 43% coverage: 334:603/635 of query aligns to 73:349/380 of 8hxgA
Sites not aligning to the query:
>PP_2554 FitnessBrowser__Putida:PP_2554
MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYAGSPRQVRQMCADLGIAITLF
QPFRDFEGCRRDRLQKNLDRAERKFDLMQELGTDLVLVCSNVQADALGDEQLLVDDLRLL
GEHAGKRGLRIGYEALAWGRHVNTYQQVWNLVRQADHPALGVILDSFHTLSLKGDPSAIR
DIPGDKIFFVQMADAPILAMDVLEWSRHFRCFPGQGEMDMAGFLAPILATGYRGPLSLEI
FNDGFRAAPTRQNAADGLRSLLYLEEQTRLRLEQENTPIEPGVLFSPPPASAYDGVEFLE
FAVDEAVGARLGNWLKRLGFAEAGKHRSKEVQLLRQGDINIVLNAEPYSFGHNFFEAHGP
SLCATALRVKDQQAALKRATAFRGQPFRGLVGPNECEVPAVRAPDGSLLYLVEQGTAGHT
LYDTDFSLDNNATATGGLRRIDHMALALPAESLDSWVLFYKSLFDFAADDEVVLPDPYGL
VKSRALRSQCGTLRLPLNISENRNTAIAHALSSYRGSGVHHIAFDCDDIFREVARAKLAG
VPLLEIPLNYYDDLAARFDFDDEFLSELAYYNVLYDRDAQGGELFHVYTEPFEERFFFEI
IQRKAGYAGYGAANVAVRLAAMAKARSGAARKPVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory