Comparing PP_2569 FitnessBrowser__Putida:PP_2569 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 40% coverage: 17:241/558 of query aligns to 34:272/583 of Q9Y7Q9
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 44% coverage: 4:250/558 of query aligns to 24:288/572 of O42885
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 42% coverage: 16:252/558 of query aligns to 37:286/559 of Q09852
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 40% coverage: 16:237/558 of query aligns to 35:228/444 of Q8NLB7
Sites not aligning to the query:
8fvzA Pipt y150a
25% identity, 55% coverage: 23:329/558 of query aligns to 4:313/433 of 8fvzA
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 27% coverage: 76:228/558 of query aligns to 187:325/616 of P36035
Sites not aligning to the query:
P38695 Probable glucose transporter HXT5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 47% coverage: 70:331/558 of query aligns to 143:422/592 of P38695
Sites not aligning to the query:
Q12300 High glucose sensor RGT2; Low-affinity glucose receptor RGT2; Low-affinity transporter-like sensor RGT2; Restores glucose transport protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
24% identity, 45% coverage: 79:329/558 of query aligns to 158:432/763 of Q12300
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 51% coverage: 88:373/558 of query aligns to 92:419/580 of Q9C757
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
25% identity, 26% coverage: 80:226/558 of query aligns to 204:347/727 of Q9Z2I6
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
25% identity, 26% coverage: 80:226/558 of query aligns to 204:347/727 of Q496J9
Sites not aligning to the query:
>PP_2569 FitnessBrowser__Putida:PP_2569
MAVLDSTSTGSAPQRGITKEERKVIFASSLGTVFEWYDFYLYGSLAAIIARHFFAGVNET
TSFIFALLAFAAGFAVRPFGAIVFGRLGDMIGRKYTFLITIVIMGLSTAVVGLLPGYATI
GVAAPIILITLRLLQGLALGGEYGGAATYVAEHAPKGRRGFFTAWIQTTATLGLFLSLLV
IMACRTAMGTEAFEAWGWRIPFLLSILLLAISVYIRLQLNESPVFMKMKAEGKASKAPLT
ESFARWDNLKVVIMSLLGGTAGQAVVWYTGQFYALFFLLQTLKIEAQTANLLIAGSLLIG
TPFFIFFGSLSDRIGRKKIIMAGCIIAALTYFPIFKALTEYGNPDVFVAQEQNPVVVVAD
PGQCAFQFDPVGKAKFTSSCDIAKSLLAKRAIPYTNEAAEPGSVAQIRIGERVLPSFDGS
SLAAADFKVQSEAFTATLSGALKEAGYPEKADQAKIHYPMVLLLLTILVIYVTMVYGPIA
AWLVELFPARIRYTSMSLPYHIGNGWFGGFLPTVAFAMVAATGDIYYGLWYPIVIAVMTA
VLGIFFLPETKDRDITHT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory