Comparing PP_2592 FitnessBrowser__Putida:PP_2592 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 88% coverage: 14:239/258 of query aligns to 24:251/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 86% coverage: 1:223/258 of query aligns to 1:223/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
36% identity, 84% coverage: 12:227/258 of query aligns to 16:231/280 of 5x40A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 87% coverage: 1:225/258 of query aligns to 2:225/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 88% coverage: 1:226/258 of query aligns to 17:238/378 of P69874
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
30% identity, 83% coverage: 1:215/258 of query aligns to 1:224/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
29% identity, 83% coverage: 1:215/258 of query aligns to 1:224/230 of 1l2tA
8hplC Lpqy-sugabc in state 1 (see paper)
32% identity, 81% coverage: 16:223/258 of query aligns to 4:219/384 of 8hplC
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 88% coverage: 1:228/258 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 88% coverage: 1:228/258 of query aligns to 3:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 88% coverage: 1:228/258 of query aligns to 3:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 88% coverage: 1:228/258 of query aligns to 3:230/242 of 2oljA
8hprC Lpqy-sugabc in state 4 (see paper)
32% identity, 79% coverage: 21:223/258 of query aligns to 23:221/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
32% identity, 79% coverage: 21:223/258 of query aligns to 23:221/362 of 8hprD
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 3:216/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 1:214/367 of 1q12A
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 3:216/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 3:216/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 3:216/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
32% identity, 84% coverage: 2:219/258 of query aligns to 3:216/371 of 3puvA
>PP_2592 FitnessBrowser__Putida:PP_2592
MITVHDLHKTYGSKEVLSGVSASFPRGQLTSLIGPNGAGKSTLLMMLARLLAPASGDIRL
DGQSIDSIAIGDYARRVATLRQSVDFNLRLTVDELVAFGRFPYSRGALTAADRRAIDQAI
AFLSLEPLRQAYLNELSGGQRQMAFLAMTIAQQTDYLLLDEPLNNLDMRHAVQIMRALRR
LCDEFGRTVILVVHDINFAAAYSDCIVAMQGGRVHCSGSVEQVVTERQLHALYGLDFDIT
HSARGRLCNYFNPPGEQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory