Comparing PP_2639 FitnessBrowser__Putida:PP_2639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 99% coverage: 4:287/288 of query aligns to 2:292/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
30% identity, 99% coverage: 4:287/288 of query aligns to 3:293/295 of 1o5kA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
34% identity, 99% coverage: 4:287/288 of query aligns to 2:289/292 of Q07607
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
32% identity, 91% coverage: 7:268/288 of query aligns to 10:275/307 of 4fhaA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 95% coverage: 7:279/288 of query aligns to 15:289/300 of P9WP25
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
31% identity, 95% coverage: 7:279/288 of query aligns to 11:285/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
31% identity, 95% coverage: 7:279/288 of query aligns to 12:286/297 of 5j5dA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
32% identity, 99% coverage: 4:287/288 of query aligns to 2:290/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
32% identity, 99% coverage: 4:287/288 of query aligns to 2:290/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
32% identity, 99% coverage: 4:287/288 of query aligns to 3:291/293 of 5t25A
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
31% identity, 95% coverage: 7:279/288 of query aligns to 10:284/295 of 3l21B
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
32% identity, 99% coverage: 4:287/288 of query aligns to 2:290/292 of 3i7sA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
29% identity, 99% coverage: 4:287/288 of query aligns to 2:289/291 of 3pueB
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
28% identity, 99% coverage: 1:286/288 of query aligns to 2:292/295 of 5ktlA
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
26% identity, 97% coverage: 6:283/288 of query aligns to 6:288/296 of 7kg2A
>PP_2639 FitnessBrowser__Putida:PP_2639
MSNFRGIWIALVTPMRANEIDFPGLEKLVKKLLEDGVAGFVVCGTTGEAAALSKAEQLAV
LDAVLAWVEPGRMVMGLSGYNLRELLAFQAEIQQRDIGGLLVPAPCYIRPSQAGIEAFFA
TVADAASVPVIVYDIPYRTGVRIERETLRRIVRHPRIAAVKDCGGDSETTMALIEDGHAQ
VLAGEDLQIFNNLCLGGAGAISASAHVRADLYVRMVRQVDSGDWAAARGTFYQLLPWIKV
AFAEPNPAVVKAALQLQSLIADELREPMQTCTNTTRDKLQSVLCSLGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory