Comparing PP_2689 FitnessBrowser__Putida:PP_2689 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
39% identity, 81% coverage: 11:110/123 of query aligns to 11:111/124 of 3k0tC
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
43% identity, 74% coverage: 20:110/123 of query aligns to 21:112/126 of 2b33B
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
35% identity, 92% coverage: 11:123/123 of query aligns to 11:123/124 of 7cd4A
Sites not aligning to the query:
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
37% identity, 88% coverage: 14:121/123 of query aligns to 16:125/127 of 5v4dA
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 74% coverage: 21:111/123 of query aligns to 23:116/128 of Q7CP78
Sites not aligning to the query:
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
37% identity, 74% coverage: 21:111/123 of query aligns to 22:116/127 of 3vczB
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
36% identity, 89% coverage: 1:110/123 of query aligns to 1:117/137 of P52759
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
36% identity, 81% coverage: 11:110/123 of query aligns to 16:117/137 of P80601
Sites not aligning to the query:
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
33% identity, 76% coverage: 21:114/123 of query aligns to 22:118/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
33% identity, 76% coverage: 21:114/123 of query aligns to 22:118/127 of 2uykC
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
32% identity, 79% coverage: 14:110/123 of query aligns to 17:115/128 of A0A1J1DL12
Sites not aligning to the query:
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
31% identity, 90% coverage: 11:121/123 of query aligns to 13:124/128 of P0AFQ5
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 87% coverage: 2:108/123 of query aligns to 64:173/187 of Q94JQ4
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
37% identity, 62% coverage: 33:108/123 of query aligns to 19:94/108 of 5hp8A
3i3fB Hypothetical protein from giardia lamblia gl50803_14299
34% identity, 78% coverage: 23:118/123 of query aligns to 23:121/128 of 3i3fB
Sites not aligning to the query:
3i3fA Hypothetical protein from giardia lamblia gl50803_14299
34% identity, 78% coverage: 23:118/123 of query aligns to 26:124/131 of 3i3fA
Sites not aligning to the query:
>PP_2689 FitnessBrowser__Putida:PP_2689
MKHAIKTELFASRAPLEWAVVGNGTLYTAQIPIDTQGQVVAGGIEAQARQTLDNLRHTLE
AAGSSLDAVTQVLIYVTDRRYLATVNAVYAEYFQAPYPNRAAVVVAGLAREEMLVELVVY
ACL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory