Comparing PP_2759 PP_2759 ribose ABC transporter - ATP-binding subunit to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 5:502/512 of query aligns to 4:501/501 of P04983
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 39% coverage: 1:200/512 of query aligns to 2:197/240 of 1ji0A
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 39% coverage: 20:219/512 of query aligns to 15:205/348 of 3d31A
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 48% coverage: 2:247/512 of query aligns to 1:251/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 48% coverage: 2:247/512 of query aligns to 1:251/254 of 1g6hA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 48% coverage: 3:246/512 of query aligns to 15:251/378 of P69874
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 42% coverage: 5:218/512 of query aligns to 1:217/343 of P30750
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 43% coverage: 8:226/512 of query aligns to 4:220/240 of 4ymuJ
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 42% coverage: 5:218/512 of query aligns to 2:218/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 42% coverage: 5:218/512 of query aligns to 2:218/344 of 3tuiC
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
33% identity, 43% coverage: 5:225/512 of query aligns to 3:222/230 of 6z4wA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 42% coverage: 5:218/512 of query aligns to 2:218/344 of 6cvlD
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
33% identity, 43% coverage: 5:225/512 of query aligns to 3:222/229 of 6z67B
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
25% identity, 47% coverage: 5:247/512 of query aligns to 2:233/240 of 6mjpA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
30% identity, 43% coverage: 5:226/512 of query aligns to 2:220/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
30% identity, 43% coverage: 5:226/512 of query aligns to 2:220/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 43% coverage: 5:226/512 of query aligns to 2:220/233 of 6b8bA
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
27% identity, 48% coverage: 6:251/512 of query aligns to 319:557/865 of O65934
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 43% coverage: 5:226/512 of query aligns to 2:220/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 43% coverage: 5:226/512 of query aligns to 2:220/238 of 6s8nB
>PP_2759 PP_2759 ribose ABC transporter - ATP-binding subunit
MSTPVLELRGIVKTFGATRALDGASLRVAAGSVHGLVGENGAGKSTLIKVLAGIHRPDAG
SLLLDGQPHGHFSPRQVERLGIGFIHQERLLPARFTVGEALFFGHERRFGPLLDRRSQQR
EAARLLDDYFGLRLPANALIGELSSAEQQMVQIVRALLIKPRVLVFDEPSVALVQREVER
LLRIVQRLRDDGLAIVYISHYLQEIEALCDRVTVLRNGRDVAEVSPRNTSLEQITRLMVN
REVGELYPKVAVPAGALLLDVRGLGRARAYQGIDLQVRRGEIVGLTGLVGSGAKELLRSL
FGLAPPDSGEVRLDGQPLSLRSPREAVAQGVALMPEERRRQGVALDLSVQENTTLAALSR
FVRLGLLSPARERHTTLELIERLRIKAHGAHAKVRQLSGGNQQKVALAKWFARCSSLYLL
DEPSVGIDVGAKVEIYRLIGELVKEGAGVLILSSDLPELIGLCDRIHVMHRGAIAARFAA
GEANSDRLLAVATGAQRAQNEERPFYAYAIAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory