Comparing PP_2767 FitnessBrowser__Putida:PP_2767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 91% coverage: 3:254/277 of query aligns to 1:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 91% coverage: 3:254/277 of query aligns to 1:253/254 of 1g6hA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:235/238 of 6s8gA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 90% coverage: 5:254/277 of query aligns to 16:249/378 of P69874
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 90% coverage: 6:254/277 of query aligns to 2:235/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 89% coverage: 7:253/277 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 89% coverage: 7:253/277 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 89% coverage: 7:252/277 of query aligns to 3:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 90% coverage: 6:255/277 of query aligns to 6:239/240 of 1ji0A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
27% identity, 88% coverage: 22:265/277 of query aligns to 42:273/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
27% identity, 88% coverage: 22:265/277 of query aligns to 42:273/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
27% identity, 81% coverage: 22:246/277 of query aligns to 42:254/260 of 7ahdC
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 83% coverage: 6:236/277 of query aligns to 4:222/501 of P04983
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:234/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:234/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 90% coverage: 7:254/277 of query aligns to 3:234/371 of 3puwA
>PP_2767 FitnessBrowser__Putida:PP_2767
MSNLPLLELEGISLSFKGVKAISDIGFSVAEGEICALIGPNGAGKSSLLNIINGVYRAQQ
GRIRFAGQQRRVMHPHAAARDGIARTFQNIALFKGMSVLDNVLTGRNLKRRSSWLEQALR
IGRAPGEDDRQRAAAERVIEFLRIQPWRDEIVGTLPYGLQKRIELARALAAEPRLLLLDE
PMAGMNAEEKREMSRFIVEINREFGMTVVLIEHDIGVVMGISHHVVVLDYGRKIGDGSPE
QVRRNPDVIAAYLGVRPAAASGLFPHRSATWHSFSKC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory