SitesBLAST
Comparing PP_2794 FitnessBrowser__Putida:PP_2794 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
42% identity, 96% coverage: 9:252/255 of query aligns to 4:245/246 of 4hp8B
- active site: G19 (= G24), S138 (= S146), V148 (= V156), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), N17 (≠ S22), T18 (≠ S23), G19 (= G24), L20 (= L25), R40 (= R45), R41 (= R46), D63 (= D70), F64 (≠ V71), N85 (= N93), G87 (= G95), I88 (≠ V96), I136 (≠ V144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (≠ V192), T186 (= T194), N188 (≠ L196), T189 (≠ N197)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 93% coverage: 14:249/255 of query aligns to 5:243/246 of 3osuA
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
35% identity, 95% coverage: 9:251/255 of query aligns to 6:245/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ S22), L22 (= L25), I42 (≠ Q47), D65 (= D70), M66 (≠ V71), N92 (= N93), A93 (= A94), G94 (= G95), L115 (≠ T116), I143 (≠ V144), S145 (= S146), Y158 (= Y159), K162 (= K163), G189 (= G190), M191 (≠ V192), T193 (= T194), N195 (≠ L196)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 93% coverage: 14:249/255 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G24), S138 (= S146), Q148 (vs. gap), Y151 (= Y159), K155 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), S10 (= S22), R11 (≠ S23), I13 (≠ L25), N31 (≠ T43), Y32 (vs. gap), A33 (= A44), G34 (≠ R45), S35 (≠ R46), A58 (≠ L69), N59 (≠ D70), V60 (= V71), N86 (= N93), A87 (= A94), T109 (= T116), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
37% identity, 95% coverage: 9:249/255 of query aligns to 12:256/261 of 5u9pB
- active site: G27 (= G24), S152 (= S146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G20), R26 (≠ S23), G27 (= G24), I28 (≠ L25), R48 (= R45), D73 (= D70), V74 (= V71), N100 (= N93), A101 (= A94), I150 (≠ V144), Y165 (= Y159), K169 (= K163), P195 (= P189), F198 (≠ V192), T200 (= T194), L202 (= L196), N203 (= N197)
1cydA Carbonyl reductase complexed with NADPH and 2-propanol (see paper)
37% identity, 95% coverage: 11:253/255 of query aligns to 3:242/242 of 1cydA
- active site: G16 (= G24), S134 (= S146), L144 (≠ V156), Y147 (= Y159), K151 (= K163)
- binding isopropyl alcohol: S134 (= S146), Y147 (= Y159), V188 (≠ F200)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), G14 (≠ S22), K15 (≠ S23), I17 (≠ L25), R37 (= R45), T38 (≠ R46), D58 (= D70), L59 (≠ V71), N81 (= N93), A83 (≠ G95), V104 (≠ T116), V132 (= V144), S134 (= S146), Y147 (= Y159), K151 (= K163), P177 (= P189), T178 (≠ G190), V179 (≠ Y191), V180 (= V192), T182 (= T194), M184 (≠ L196), G185 (≠ N197)
P08074 Carbonyl reductase [NADPH] 2; Adipocyte protein P27; AP27; Lung carbonyl reductase; LCR; NADPH-dependent carbonyl reductase 2; EC 1.1.1.184 from Mus musculus (Mouse) (see 2 papers)
37% identity, 95% coverage: 11:253/255 of query aligns to 5:244/244 of P08074
- 11:39 (vs. 17:45, 52% identical) binding
- T38 (≠ A44) mutation to R: Converts the coenzyme specificity from NADP to NAD.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 95% coverage: 8:249/255 of query aligns to 1:248/252 of 1vl8B
- active site: G17 (= G24), S143 (= S146), I154 (≠ V156), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), R16 (≠ S23), G17 (= G24), L18 (= L25), S37 (≠ A44), R38 (= R45), C63 (≠ L69), D64 (= D70), V65 (= V71), A91 (≠ N93), A92 (= A94), G93 (= G95), I94 (≠ V96), V114 (≠ T116), I141 (≠ V144), S143 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), Y190 (≠ V192), T192 (= T194), M194 (≠ L196), T195 (≠ N197)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
38% identity, 94% coverage: 11:249/255 of query aligns to 5:240/244 of 3d3wA
- active site: G18 (= G24), S136 (= S146), H146 (≠ V156), Y149 (= Y159), K153 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ S22), K17 (≠ S23), G18 (= G24), I19 (≠ L25), S38 (≠ A44), R39 (= R45), T40 (≠ R46), V59 (≠ L69), L61 (≠ V71), N83 (= N93), A84 (= A94), A85 (≠ G95), V106 (≠ T116), V134 (= V144), S135 (≠ T145), S136 (= S146), Y149 (= Y159), K153 (= K163), P179 (= P189), T180 (≠ G190), V182 (= V192), T184 (= T194), S185 (≠ D195), M186 (≠ L196), G187 (≠ N197)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
38% identity, 94% coverage: 11:249/255 of query aligns to 5:240/244 of 1pr9A
- active site: G18 (= G24), S136 (= S146), H146 (≠ V156), Y149 (= Y159), K153 (= K163)
- binding dihydrogenphosphate ion: S136 (= S146), C138 (≠ L148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), G16 (≠ S22), K17 (≠ S23), G18 (= G24), I19 (≠ L25), S38 (≠ A44), R39 (= R45), T40 (≠ R46), L61 (≠ V71), N83 (= N93), A85 (≠ G95), V106 (≠ T116), V134 (= V144), Y149 (= Y159), K153 (= K163), T180 (≠ G190), V182 (= V192), T184 (= T194), M186 (≠ L196)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
38% identity, 94% coverage: 11:249/255 of query aligns to 5:240/244 of Q7Z4W1
- 11:40 (vs. 17:46, 50% identical) binding
- N107 (= N117) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S146) binding
- K153 (= K163) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
39% identity, 93% coverage: 14:249/255 of query aligns to 6:250/256 of 7do7A
- active site: G16 (= G24), S146 (= S146), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), R15 (≠ S23), G16 (= G24), I17 (≠ L25), S37 (vs. gap), D66 (vs. gap), A67 (= A68), N93 (= N93), A94 (= A94), G95 (= G95), I96 (≠ V96), V144 (= V144), S145 (≠ T145), S146 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (≠ V192), T194 (= T194), I196 (≠ L196)
- binding beta-L-rhamnopyranose: F99 (≠ S99), S146 (= S146), S148 (≠ A149), Q156 (≠ G157), Y159 (= Y159), N197 (= N197), D235 (= D234), M236 (≠ A235), R238 (= R237)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
39% identity, 93% coverage: 14:249/255 of query aligns to 6:250/256 of 7b81A
- active site: G16 (= G24), S146 (= S146), Y159 (= Y159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S14 (= S22), R15 (≠ S23), I17 (≠ L25), D66 (vs. gap), A67 (= A68), N93 (= N93), A94 (= A94), G95 (= G95), I96 (≠ V96), T116 (= T116), V144 (= V144), S146 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), I192 (≠ V192), T194 (= T194), I196 (≠ L196)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
37% identity, 95% coverage: 7:249/255 of query aligns to 5:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), S20 (= S22), K21 (≠ S23), G22 (= G24), I23 (≠ L25), A43 (= A44), S44 (≠ R45), S45 (≠ R46), G68 (≠ L69), D69 (= D70), V70 (= V71), N96 (= N93), S97 (≠ A94), G98 (= G95), Y100 (≠ S97), I144 (≠ V144), S146 (= S146), Y159 (= Y159), K163 (= K163), P189 (= P189), G190 (= G190), M191 (≠ Y191), I192 (≠ V192), T194 (= T194), G196 (≠ L196), T197 (≠ N197)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S146), Y159 (= Y159), M191 (≠ Y191), I202 (≠ F200)
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
36% identity, 96% coverage: 9:253/255 of query aligns to 3:244/244 of Q920P0
- S136 (= S146) mutation to A: Loss of activity.
- Q137 (≠ I147) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (≠ A153) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (≠ V156) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y159) mutation to F: Loss of activity.
- K153 (= K163) mutation to M: Loss of activity.
- N190 (≠ F200) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (≠ L201) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 96% coverage: 9:253/255 of query aligns to 3:249/249 of 3uf0A
- active site: G18 (= G24), S141 (= S146), V151 (= V156), Y154 (= Y159), K158 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (= S23), G18 (= G24), I19 (≠ L25), R39 (= R45), D63 (= D70), L64 (≠ V71), N89 (= N93), G91 (= G95), I92 (≠ V96), I139 (≠ V144), A140 (≠ T145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), V187 (= V192), T189 (= T194), N191 (≠ L196), T192 (≠ N197)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 96% coverage: 6:249/255 of query aligns to 1:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), I20 (≠ L25), T40 (≠ R45), N62 (≠ D70), V63 (= V71), N89 (= N93), A90 (= A94), I92 (≠ V96), V139 (= V144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (≠ V192), T189 (= T194), M191 (≠ L196)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 95% coverage: 9:249/255 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G24), S138 (= S146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (≠ S23), T37 (≠ R45), L58 (= L69), N59 (≠ D70), V60 (= V71), A87 (= A94), G88 (= G95), I89 (≠ V96)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 96% coverage: 6:249/255 of query aligns to 1:239/243 of 4i08A
- active site: G19 (= G24), N113 (= N117), S141 (= S146), Q151 (≠ V156), Y154 (= Y159), K158 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), S17 (= S22), R18 (≠ S23), I20 (≠ L25), T40 (≠ R45), N62 (≠ D70), V63 (= V71), N89 (= N93), A90 (= A94), G140 (≠ T145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), T189 (= T194)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
34% identity, 95% coverage: 11:251/255 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G24), S142 (= S146), Q152 (≠ V156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (= S22), R15 (≠ S23), G16 (= G24), I17 (≠ L25), N35 (≠ T43), Y36 (≠ R45), N37 (≠ R46), G38 (≠ Q47), S39 (≠ A48), N63 (≠ D70), V64 (= V71), N90 (= N93), A91 (= A94), I93 (≠ V96), I113 (≠ T116), S142 (= S146), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (≠ V192), T190 (= T194)
Query Sequence
>PP_2794 FitnessBrowser__Putida:PP_2794
MQPNLARLFALDGRRALVTGASSGLGRHFAMTLAAAGAEVVVTARRQAPLQALVEAIEVA
GGRAQAFALDVTSREDICRVLDAAGPLDVLVNNAGVSDSQPLLACDDQTWDHVLDTNLKG
AWAVAQESARRMVVAGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARH
GIRVNALAPGYVMTDLNEAFLASEAGDKLRSRIPSRRFSVPSDLDGALLLLASDAGRAMS
GAEIVVDGGHLCSSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory