SitesBLAST
Comparing PP_2802 FitnessBrowser__Putida:PP_2802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
42% identity, 96% coverage: 10:436/443 of query aligns to 18:447/461 of P76037
- Y110 (= Y102) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
26% identity, 96% coverage: 1:425/443 of query aligns to 11:443/456 of 5oqtA
- binding alanine: I38 (≠ L27), G40 (≠ P29), T41 (≠ L30), G42 (≠ I31), F226 (≠ Y208), A227 (≠ S209), I229 (≠ L211)
- binding : E24 (≠ S13), G26 (= G15), F28 (= F17), D29 (≠ S18), M32 (≠ L21), A176 (≠ N149), R177 (= R150), A184 (≠ V157), A188 (≠ V161), L192 (≠ V165), Q294 (≠ G277), V297 (≠ F280)
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
26% identity, 96% coverage: 1:425/443 of query aligns to 13:445/458 of 6f34A
- binding arginine: I40 (≠ L27), G42 (≠ P29), T43 (≠ L30), G44 (≠ I31), E115 (≠ D101), Y116 (= Y102), A119 (vs. gap), F228 (≠ Y208), A229 (≠ S209), I231 (≠ L211), V314 (≠ A295)
- binding cholesterol: W201 (≠ H172), Y202 (= Y173)
- binding : G28 (= G15), F30 (= F17), D31 (≠ S18), M34 (≠ L21), A178 (≠ N149), R179 (= R150), A186 (≠ V157), I187 (≠ V158), A190 (≠ V161), L194 (≠ V165), Q296 (≠ G277), V299 (≠ F280)
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
24% identity, 72% coverage: 2:318/443 of query aligns to 5:334/489 of P25737
- Y102 (≠ A98) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (≠ Y102) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (≠ Q159) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (≠ Y208) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (≠ D214) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E222) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (vs. gap) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (≠ L263) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 438 E→A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
P24207 Phenylalanine-specific permease; Phenylalanine:H(+) symporter PheP from Escherichia coli (strain K12) (see 3 papers)
22% identity, 89% coverage: 2:394/443 of query aligns to 11:411/458 of P24207
- R26 (≠ F17) mutation R->G,S,Q: Strong decrease in phenylalanine transport activity.
- P54 (≠ N45) mutation to A: 50% of wild-type phenylalanine transport activity.; mutation to G: No change in phenylalanine transport activity.; mutation to L: 26% of wild-type phenylalanine transport activity.
- F87 (≠ A78) mutation to L: No effect on phenylalanine transport activity.
- F90 (≠ Y81) mutation to L: 65% of wild-type phenylalanine transport activity.
- Y92 (≠ R83) mutation to L: 41% of wild-type phenylalanine transport activity.
- Y94 (≠ M85) mutation to L: 69% of wild-type phenylalanine transport activity.
- W95 (≠ L86) mutation to L: 10% of wild-type phenylalanine transport activity.
- F98 (≠ N89) mutation to L: No effect on phenylalanine transport activity.
- F101 (= F92) mutation to L: 38% of wild-type phenylalanine transport activity.
- W105 (= W96) mutation to L: 39% of wild-type phenylalanine transport activity.
- Y107 (≠ A98) mutation to L: No effect on phenylalanine transport activity.
- W108 (≠ L99) mutation to L: 71% of wild-type phenylalanine transport activity.
- F111 (≠ Y102) mutation to L: 60% of wild-type phenylalanine transport activity.; mutation to Y: Enables the transport of tryptophan to almost the same steady-state level as that of phenylalanine.
- E118 (≠ I109) mutation E->G,L,V,N: Loss of activity.
- K168 (≠ Q159) mutation K->L,R: Strong decrease in phenylalanine transport activity.; mutation to N: Loss of activity.
- E226 (≠ D214) mutation E->A,Q,K,R,W: Loss of activity.
- R252 (≠ I240) mutation R->D,E,F,W,P: Loss of activity.
- P341 (= P331) mutation to A: 5% of wild-type phenylalanine transport activity.; mutation P->G,Q,K,R: Loss of activity.; mutation to S: 3% of wild-type phenylalanine transport activity.; mutation to T: 17% of wild-type phenylalanine transport activity.
Sites not aligning to the query:
- 442 P→A: 46% of wild-type phenylalanine transport activity.; P→G: 52% of wild-type phenylalanine transport activity.; P→L: 43% of wild-type phenylalanine transport activity.
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
25% identity, 64% coverage: 49:331/443 of query aligns to 41:323/433 of 6f2wA
Sites not aligning to the query:
P46349 Gamma-aminobutyric acid permease; GABA permease; 4-aminobutyrate permease; Gamma-aminobutyrate permease; Proline transporter GabP from Bacillus subtilis (strain 168) (see paper)
22% identity, 72% coverage: 1:319/443 of query aligns to 1:321/469 of P46349
- G33 (≠ T35) mutation to D: Lack of activity.
- G42 (= G44) mutation to S: Lack of activity.
- G301 (= G296) mutation to V: Lack of activity.
Sites not aligning to the query:
- 338 G→E: Lack of activity.
- 341 F→S: Lack of activity.
- 414 G→R: Lack of activity.
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
23% identity, 85% coverage: 4:380/443 of query aligns to 22:435/629 of P30825
- N226 (≠ L183) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
24% identity, 74% coverage: 5:331/443 of query aligns to 3:328/438 of O34739
- C94 (≠ V94) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (vs. gap) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (= C170) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (≠ A295) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
Sites not aligning to the query:
- 415 C→S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
23% identity, 72% coverage: 1:320/443 of query aligns to 2:324/457 of P15993
- Y103 (= Y102) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
Q9URZ4 Cationic amino acid transporter 1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 40% coverage: 60:237/443 of query aligns to 131:311/587 of Q9URZ4
Sites not aligning to the query:
- 29 modified: Phosphoserine
- 30 modified: Phosphoserine
- 37 modified: Phosphoserine
P82251 b(0,+)-type amino acid transporter 1; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; Solute carrier family 7 member 9 from Homo sapiens (Human) (see 11 papers)
25% identity, 85% coverage: 1:376/443 of query aligns to 17:399/487 of P82251
- V40 (≠ A28) to M: in CSNU; uncertain significance
- IIGSG 43:47 (≠ IV-FG 31:34) binding
- I44 (≠ V32) to T: in CSNU; type I; dbSNP:rs121908485
- S51 (≠ V38) to F: in CSNU; uncertain significance
- P52 (≠ I39) to L: in CSNU; impairs protein stability and dimer formation; dbSNP:rs1198613438
- A70 (= A54) to V: in CSNU; partial loss of amino acid transport activity; dbSNP:rs769448665
- Y99 (= Y81) to H: in CSNU; uncertain significance
- G105 (≠ N87) to R: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908480
- W114 (= W96) to R: in CSNU; uncertain significance
- I120 (≠ Y102) to L: in CSNU; uncertain significance
- T123 (≠ I105) to M: in CSNU; partial loss of amino acid transport activity; dbSNP:rs79987078
- V142 (≠ L117) to A: no effect on amino acid transport activity; dbSNP:rs12150889
- C144 (≠ M119) modified: Interchain (with C-114 in SLC3A1)
- V170 (≠ I145) to M: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908479
- A182 (≠ V157) to T: in CSNU; type III; partial loss of amino acid transport activity; dbSNP:rs79389353
- G195 (= G168) to R: in CSNU; type III; decreased amino acid transport activity; dbSNP:rs121908482
- L223 (≠ I205) to M: slightly decreased amino acid transport activity; dbSNP:rs1007160
- A224 (= A206) to V: in CSNU; non-classic type I; dbSNP:rs140873167
- N227 (≠ S209) to D: in CSNU; decreased amino acid transport activity
- W230 (vs. gap) to R: in CSNU; complete loss of amino acid transport activity; mutation to A: Abolishes amino acid transport activity.
- D233 (≠ L211) binding ; mutation to A: Complete loss of amino acid transport activity.
- W235 (≠ F213) mutation to A: Complete loss of amino acid transport activity.
- Q237 (≠ A215) mutation to A: Reduces amino acid transport activity.
- G259 (≠ V237) to R: in CSNU; type III; impairs protein stability and dimer formation; dbSNP:rs121908483
- P261 (≠ L239) to L: in CSNU; types I and III; dbSNP:rs121908486
- S286 (≠ G266) to F: in CSNU; uncertain significance; dbSNP:rs755135545
- C321 (≠ S298) mutation to S: Does not affect amino acid transport activity.
- A324 (= A301) to E: in CSNU; uncertain significance
- V330 (≠ A309) to M: in CSNU; type III; dbSNP:rs201618022
- A331 (≠ L310) to V: in CSNU; non-classic type I; dbSNP:rs768466784
- R333 (= R312) to Q: in CSNU; decreased amino acid transport activity; dbSNP:rs769576205; to W: in CSNU; severe loss of amino acid transport activity; dbSNP:rs121908484
- A354 (≠ N334) to T: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs939028046
- S379 (≠ A361) mutation to A: Markedly reduces amino acid transport activity.
- A382 (= A364) to T: in CSNU; severe loss of amino acid transport activity; dbSNP:rs774878350
- W383 (≠ F365) mutation to A: Complete loss of amino acid transport activity.
- Y386 (vs. gap) mutation to A: Loss of amino acid transport activity.
Sites not aligning to the query:
- 401 K → E: in CSNU; uncertain significance; dbSNP:rs760264924
- 426 L → P: in CSNU; uncertain significance
- 482 P → L: in CSNU; severe loss of amino acid transport activity; no effect on localization to the apical membrane; dbSNP:rs146815072; mutation P->A,G,S,V: No effect on amino acid transport activity.; mutation P->F,I,M,W: Decreased amino acid transport activity.
6li9B Heteromeric amino acid transporter b0,+at-rbat complex bound with arginine (see paper)
25% identity, 73% coverage: 54:376/443 of query aligns to 41:370/458 of 6li9B
Sites not aligning to the query:
P04817 Arginine permease CAN1; Canavanine resistance protein 1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 66% coverage: 64:355/443 of query aligns to 139:442/590 of P04817
- P148 (= P73) mutation to L: In CAN1-337; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, but not sensitivity to L-aspartic acid alpha-hydroxamate or p-fluoro-L-phenylalanine.
- V149 (= V74) mutation to F: In CAN1-315; confers citrulline transport activity in GAP1-deleted cells.
- S152 (= S77) mutation to F: In CAN1-342; confers citrulline transport activity in GAP1-deleted cells.
- Y173 (= Y102) mutation to D: In CAN1-306; confers citrulline transport activity in GAP1-deleted cells.; mutation to H: In CAN1-327; confers citrulline transport activity in GAP1-deleted cells.
- G308 (≠ E221) mutation to A: In CAN1-341; confers citrulline transport activity in GAP1-deleted cells.
- P313 (= P226) mutation to S: In CAN1-329; confers citrulline transport activity in GAP1-deleted cells and leads to sensitivity to L-glutamic acid alpha-hydroxamate, alpha-aminoisobutyrate, 3-chloro-L-alanine, L-ethionine, L-allylglycine, and D-histidine, L-aspartic acid alpha-hydroxamate and p-fluoro-L-phenylalanine.
- TS 354:355 (≠ FE 261:262) mutation Missing: In CAN1-318; confers citrulline transport activity in GAP1-deleted cells.
- Y356 (≠ L263) mutation to H: In CAN1-340; confers citrulline transport activity in GAP1-deleted cells.; mutation to N: In CAN1-339; confers citrulline transport activity in GAP1-deleted cells.
Sites not aligning to the query:
- 113 P→L: In CAN1-343; confers citrulline transport activity in GAP1-deleted cells.
- 451 W→C: In CAN1-328; confers citrulline transport activity in GAP1-deleted cells.; W→L: In CAN1-316; confers citrulline transport activity in GAP1-deleted cells.; W→S: In CAN1-335; confers citrulline transport activity in GAP1-deleted cells.
- 461 F→S: In CAN1-307; confers citrulline transport activity in GAP1-deleted cells.
3l1lA Structure of arg-bound escherichia coli adic (see paper)
22% identity, 55% coverage: 42:284/443 of query aligns to 31:261/423 of 3l1lA
Sites not aligning to the query:
Query Sequence
>PP_2802 FitnessBrowser__Putida:PP_2802
MSQSTSGASLRRSLGPFSVLLFGLAFLAPLIVFGTYGVITQASGNTTAMAYLVAATGVVF
TALSYGRLVRVFPVAGSAYTYTRKMLNANLGFMVGWAALLDYFFIPMLIWLLGASYLNMA
FPEVPQWVWITGFIVSTSLLNVLGIQVANRFNVLLMVVQLVIIAVFIGLCVHYIVAANGP
GGLLSAKPFFNQDVPFATSMAGAAIAAYSFLGFDALSTLSEETRDPGRTLPRAILLVALI
GGSVYVGSSYFMYLAHPSPTFELVDGAAFEIARMIGGDLFFAVVLTGIIVAHFAAGMSFQ
ASVGRLLYALGRDNQLPRRLFGALHPRYKTPAFNILLCGVFGTAGFGLTIATATSLVNFG
AFLAFTAVNLCALRLTFDARVKDGAGLLRGVLFPLIGLVTAGWMLVSLDKDALIMGGCWL
GLGLVYLACRTSLFRNPVPDALV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory