Comparing PP_2914 FitnessBrowser__Putida:PP_2914 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 91% coverage: 26:480/500 of query aligns to 64:577/587 of P25297
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 76% coverage: 40:420/500 of query aligns to 56:412/444 of Q8NLB7
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 32% coverage: 82:239/500 of query aligns to 98:262/583 of Q9Y7Q9
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 53% coverage: 88:351/500 of query aligns to 78:343/452 of Q5EXK5
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 66% coverage: 78:407/500 of query aligns to 186:499/616 of P36035
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
26% identity, 73% coverage: 31:393/500 of query aligns to 17:411/491 of P0AGF4
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
26% identity, 73% coverage: 31:393/500 of query aligns to 13:407/475 of 4gc0A
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
26% identity, 73% coverage: 31:393/500 of query aligns to 13:407/475 of 4gbzA
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
26% identity, 73% coverage: 31:393/500 of query aligns to 13:407/475 of 4gbyA
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
23% identity, 53% coverage: 131:395/500 of query aligns to 99:389/437 of 6rw3A
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
23% identity, 63% coverage: 88:403/500 of query aligns to 63:389/446 of A0A0H2VG78
Sites not aligning to the query:
>PP_2914 FitnessBrowser__Putida:PP_2914
MKPRKKSVQPIGLKDITIVDDAKMKKAITAAALGNAMEWFDFGVYGFVAYALGKVFFPNA
DPSVQMIAALATFSVPFLIRPLGGLFFGALGDRFGRQKILAATIVIMSLSTFAIGLIPSY
ASIGIWAPILLLLAKMAQGFSVGGEYTGASIFVAEYAPDRKRGFLGSWLDFGSIAGFVLG
AGVVVLISTVLGEEKFLDWGWRLPFFLALPLGIIGLYLRHALEETPAFQQHVDKLEQGDR
EGLASGPKVSFKEVATQHWRSLVTCIGVVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVL
IIIAIMVGMLFVQPIIGLLSDKFGRRPFIIVGSVGLLALAIPAFMLINSGVLGLIFAGLL
IIAVLLNFFIGVMASTLPAMFPTHIRYSALASAFNISVLIAGLTPTLAAWLVETTNDLYM
PAYYLMVIAAVGLVTGLTMKETANKPLRGAAPAASDIEEARELLQEHHDNIEQKIEDIDA
QIAELEAKREKLALQHPRIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory