SitesBLAST
Comparing PP_2930 FitnessBrowser__Putida:PP_2930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
48% identity, 99% coverage: 2:303/305 of query aligns to 6:319/327 of 1pwhA
- active site: K41 (= K37), A65 (≠ G61), E194 (= E187), A198 (= A191), S200 (= S193), A222 (≠ S215), A269 (= A262), C303 (= C287)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (= F36), K41 (= K37), S64 (= S60), A65 (≠ G61), N67 (= N63), A68 (= A64), F136 (= F130), G168 (= G161), G169 (= G162), G170 (= G163), G171 (= G164), A222 (≠ S215), G224 (= G217), C303 (= C287), G304 (= G288)
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
48% identity, 98% coverage: 2:299/305 of query aligns to 6:315/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P09367 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Rattus norvegicus (Rat) (see paper)
44% identity, 99% coverage: 2:303/305 of query aligns to 6:355/363 of P09367
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P20132 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Homo sapiens (Human) (see paper)
50% identity, 99% coverage: 3:303/305 of query aligns to 7:319/328 of P20132
- C303 (= C287) mutation to A: Loss of enzyme activity.
1p5jA Crystal structure analysis of human serine dehydratase (see paper)
50% identity, 99% coverage: 3:303/305 of query aligns to 4:316/319 of 1p5jA
- active site: K38 (= K37), A62 (≠ G61), E191 (= E187), A195 (= A191), S197 (= S193), A219 (≠ S215), C300 (= C287)
- binding pyridoxal-5'-phosphate: F37 (= F36), K38 (= K37), N64 (= N63), V164 (= V160), G165 (= G161), G166 (= G162), G167 (= G163), G168 (= G164), A219 (≠ S215), C300 (= C287), G301 (= G288), G302 (= G289)
2rkbA Serine dehydratase like-1 from human cancer cells (see paper)
50% identity, 97% coverage: 3:299/305 of query aligns to 4:311/318 of 2rkbA
- active site: K38 (= K37), G62 (= G61), E190 (= E187), A194 (= A191), C196 (≠ S193), S218 (= S215), A265 (= A262), C299 (= C287)
- binding pyridoxal-5'-phosphate: F37 (= F36), K38 (= K37), N64 (= N63), G164 (= G161), G165 (= G162), G166 (= G163), G167 (= G164), S218 (= S215), C299 (= C287)
Q96GA7 Serine dehydratase-like; L-serine deaminase; L-serine dehydratase/L-threonine deaminase; L-threonine dehydratase; TDH; Serine dehydratase 2; SDH 2; EC 4.3.1.19; EC 4.3.1.17 from Homo sapiens (Human) (see paper)
50% identity, 97% coverage: 3:299/305 of query aligns to 14:321/329 of Q96GA7
- G72 (= G61) mutation to A: Strongly increased enzyme activity towards threonine.
- C309 (= C287) mutation to A: Loss of enzyme activity.
5c3uA Crystal structure of a fungal l-serine ammonia-lyase from rhizomucor miehei (see paper)
36% identity, 99% coverage: 2:303/305 of query aligns to 2:313/315 of 5c3uA
- active site: K37 (= K37), G63 (= G61), E191 (= E187), S195 (≠ A191), A197 (≠ S193), S219 (= S215), T297 (≠ C287)
- binding pyridoxal-5'-phosphate: K37 (= K37), N65 (= N63), S132 (≠ F130), P163 (≠ S159), G165 (= G161), G166 (= G162), G167 (= G163), G168 (= G164), S219 (= S215), T297 (≠ C287)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 90% coverage: 7:280/305 of query aligns to 32:306/514 of P04968
- K62 (= K37) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N63) binding
- GGGGL 188:192 (= GGGGL 161:165) binding
Sites not aligning to the query:
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
32% identity, 90% coverage: 7:280/305 of query aligns to 28:302/494 of 1tdjA
- active site: K58 (= K37), A83 (≠ G61), E209 (= E187), S213 (≠ A191), C215 (≠ S193), G237 (≠ S215)
- binding pyridoxal-5'-phosphate: F57 (= F36), K58 (= K37), N85 (= N63), G184 (= G161), G185 (= G162), G186 (= G163), G187 (= G164), G237 (≠ S215), E282 (= E260)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
28% identity, 99% coverage: 2:304/305 of query aligns to 20:322/322 of 3l6bA
- active site: K54 (= K37), S77 (≠ G61), E203 (= E187), A207 (= A191), D209 (≠ S193), G232 (vs. gap), T278 (≠ A262), L305 (≠ V286), S306 (≠ C287)
- binding malonate ion: K54 (= K37), S76 (= S60), S77 (≠ G61), N79 (= N63), H80 (≠ A64), R128 (≠ A112), G232 (vs. gap)
- binding manganese (ii) ion: E203 (= E187), A207 (= A191), D209 (≠ S193)
- binding pyridoxal-5'-phosphate: F53 (= F36), K54 (= K37), N79 (= N63), G178 (= G161), G179 (= G162), G180 (= G163), G181 (= G164), M182 (≠ L165), V233 (= V212), E276 (= E260), T278 (≠ A262), S306 (≠ C287), G307 (= G288)
6zspAAA serine racemase bound to atp and malonate. (see paper)
27% identity, 100% coverage: 2:305/305 of query aligns to 19:320/320 of 6zspAAA
- active site: K53 (= K37), S74 (≠ G61), E200 (= E187), A204 (= A191), D206 (≠ S193), G229 (vs. gap), L302 (≠ V286), S303 (≠ C287)
- binding adenosine-5'-triphosphate: S28 (= S12), S29 (≠ R13), I30 (≠ P14), K48 (≠ P32), T49 (≠ C33), Q79 (≠ L66), Y111 (≠ E98), E266 (≠ H255), R267 (= R256), K269 (vs. gap), N306 (≠ A290)
- binding magnesium ion: E200 (= E187), A204 (= A191), D206 (≠ S193)
- binding malonate ion: K53 (= K37), S73 (= S60), S74 (≠ G61), N76 (= N63), H77 (≠ A64), R125 (≠ A112), G229 (vs. gap), S232 (≠ T214)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:307/310 of 7nbgDDD
- active site: K53 (= K37), S76 (≠ G61), E202 (= E187), A206 (= A191), D208 (≠ S193), G231 (vs. gap), L304 (≠ V286), S305 (≠ C287)
- binding calcium ion: E202 (= E187), A206 (= A191), D208 (≠ S193)
- binding magnesium ion: N239 (≠ Q230)
- binding ortho-xylene: S76 (≠ G61), Q81 (≠ L66), I96 (≠ V81), Y113 (≠ E98)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N78 (= N63), G177 (= G161), G178 (= G162), G179 (= G163), G180 (= G164), M181 (≠ L165), G231 (vs. gap), V232 (= V212), E275 (= E260), T277 (≠ A262), S305 (≠ C287), G306 (= G288)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/320 of 7nbhAAA
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ G61), G85 (= G65), Q86 (≠ L66), K111 (≠ A91), I115 (≠ L95), Y118 (≠ E98), D235 (≠ S211), P281 (= P261)
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/323 of 7nbfAAA
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding magnesium ion: N244 (≠ Q230)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N83 (= N63), G182 (= G161), G183 (= G162), G184 (= G163), G185 (= G164), M186 (≠ L165), G236 (vs. gap), V237 (= V212), T282 (≠ A262), S310 (≠ C287), G311 (= G288)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H4), L22 (≠ I5), T23 (= T7), P24 (= P8), L26 (≠ I10), T27 (≠ E11), F46 (≠ L30)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/323 of 7nbdAAA
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ D254), L278 (= L258)
- binding magnesium ion: N244 (≠ Q230)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N83 (= N63), G182 (= G161), G183 (= G162), G184 (= G163), G185 (= G164), M186 (≠ L165), G236 (vs. gap), V237 (= V212), E280 (= E260), T282 (≠ A262), S310 (≠ C287), G311 (= G288)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/323 of 7nbcCCC
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding biphenyl-4-ylacetic acid: T78 (≠ S58), H79 (≠ S59), H84 (≠ A64), V148 (≠ I127), H149 (= H128), P150 (= P129)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N83 (= N63), G182 (= G161), G183 (= G162), G184 (= G163), G185 (= G164), M186 (≠ L165), G236 (vs. gap), V237 (= V212), T282 (≠ A262), S310 (≠ C287), G311 (= G288)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/323 of 7nbcAAA
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding magnesium ion: N244 (≠ Q230)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N83 (= N63), G182 (= G161), G183 (= G162), G184 (= G163), G185 (= G164), M186 (≠ L165), G236 (vs. gap), V237 (= V212), T282 (≠ A262), S310 (≠ C287), G311 (= G288)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 94% coverage: 2:289/305 of query aligns to 19:312/322 of 7nbgAAA
- active site: K53 (= K37), S81 (≠ G61), E207 (= E187), A211 (= A191), D213 (≠ S193), G236 (vs. gap), L309 (≠ V286), S310 (≠ C287)
- binding calcium ion: E207 (= E187), A211 (= A191), D213 (≠ S193)
- binding pyridoxal-5'-phosphate: F52 (= F36), K53 (= K37), N83 (= N63), G182 (= G161), G183 (= G162), G184 (= G163), G185 (= G164), M186 (≠ L165), G236 (vs. gap), V237 (= V212), T282 (≠ A262), S310 (≠ C287), G311 (= G288)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ G61), G85 (= G65), Q86 (≠ L66), I101 (≠ V81), K111 (≠ A91), I115 (≠ L95), Y118 (≠ E98)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
25% identity, 88% coverage: 4:270/305 of query aligns to 34:301/339 of Q7XSN8
- E219 (= E187) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S193) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
Query Sequence
>PP_2930 FitnessBrowser__Putida:PP_2930
MTLHIHTPLIESRPLSLAAGRNIWLKLDALQPCGSFKLRGVGHACEVHHARGARHFVSSS
GGNAGLAVAYAGRKLGVPVTVVIPETTTERAKQLLHLEDAKVVVQGSSWQEANALAQTLV
GPNDAFIHPFDDPLLWAGHASLVDEVAEAGLKPDAVVLSVGGGGLLSGVVEGLKRNGWGD
VPVLAVETEGAASLHAAMQAGHSVELERIASVATSLGAKRVADQALMCVQQHPVHSHLVS
DRAALEACERFLLDHRVLVEPACGAALAVAYDAKALGALRNVLVVVCGGATATLEQIQAW
LQQAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory