SitesBLAST
Comparing PP_3120 FitnessBrowser__Putida:PP_3120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
59% identity, 100% coverage: 1:253/253 of query aligns to 23:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D49 (= D27), Y54 (= Y32), N142 (= N120), Q164 (= Q138), Y192 (= Y166), C193 (= C167), P194 (= P168), L195 (= L169), Q197 (= Q171), A198 (= A172), R200 (= R174), A223 (= A193), I239 (= I209), P240 (= P210), K241 (= K211), A242 (= A212), A243 (≠ V213), S244 (≠ A214), H247 (= H217), N251 (= N221)
Sites not aligning to the query:
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
59% identity, 100% coverage: 1:253/253 of query aligns to 24:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D50 (= D27), Y55 (= Y32), H113 (= H90), N143 (= N120), Q165 (= Q138), Y193 (= Y166), C194 (= C167), P195 (= P168), L196 (= L169), Q198 (= Q171), A199 (= A172), A224 (= A193), I240 (= I209), P241 (= P210), K242 (= K211), A243 (= A212), A244 (≠ V213), S245 (≠ A214), H248 (= H217), N252 (= N221)
Sites not aligning to the query:
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
58% identity, 100% coverage: 1:253/253 of query aligns to 26:281/281 of 5c7hA
- active site: D52 (= D27), Y57 (= Y32), K82 (= K57), H115 (= H90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D52 (= D27), Y57 (= Y32), H115 (= H90), Q167 (= Q138), Y195 (= Y166), S196 (≠ C167), P197 (= P168), L198 (= L169), E200 (≠ Q171), L204 (= L176), A221 (= A193), I237 (= I209), P238 (= P210), K239 (= K211), T240 (≠ A212), R245 (≠ H217), E248 (≠ L220), N249 (= N221), I281 (≠ V253)
Sites not aligning to the query:
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
58% identity, 100% coverage: 1:253/253 of query aligns to 26:281/281 of 4pmjA
- active site: D52 (= D27), Y57 (= Y32), K82 (= K57), H115 (= H90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D52 (= D27), H115 (= H90), Q167 (= Q138), Y195 (= Y166), S196 (≠ C167), P197 (= P168), L198 (= L169), E200 (≠ Q171), L204 (= L176), A221 (= A193), I237 (= I209), P238 (= P210), K239 (= K211), T240 (≠ A212), G241 (≠ V213), R245 (≠ H217), E248 (≠ L220), N249 (= N221)
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
40% identity, 93% coverage: 4:238/253 of query aligns to 31:272/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: Y59 (= Y32), W87 (≠ Y59), H118 (= H90), R204 (≠ Q171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y59 (= Y32), H118 (= H90), N149 (= N120), Q170 (= Q138), Y199 (= Y166), S200 (≠ C167), P201 (= P168), L202 (= L169), R204 (≠ Q171), T205 (≠ A172), Y227 (≠ A193), I243 (= I209), P244 (= P210), K245 (= K211), G247 (≠ V213), R248 (≠ A214), H251 (= H217), E254 (≠ L220), N255 (= N221)
Sites not aligning to the query:
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
40% identity, 93% coverage: 4:238/253 of query aligns to 31:272/275 of 6kikA
Sites not aligning to the query:
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
40% identity, 93% coverage: 4:238/253 of query aligns to 30:271/274 of 5danA
- active site: D53 (= D27), Y58 (= Y32), K84 (= K57), H117 (= H90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D53 (= D27), Y58 (= Y32), H117 (= H90), Q169 (= Q138), Y198 (= Y166), S199 (≠ C167), P200 (= P168), L201 (= L169), R203 (≠ Q171), Y226 (≠ A193), I242 (= I209), P243 (= P210), K244 (= K211), G246 (≠ V213), R247 (≠ A214), H250 (= H217), E253 (≠ L220), N254 (= N221)
Sites not aligning to the query:
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 89% coverage: 14:237/253 of query aligns to 31:255/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
36% identity, 91% coverage: 9:238/253 of query aligns to 25:257/277 of 4fziA
Sites not aligning to the query:
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
36% identity, 91% coverage: 9:238/253 of query aligns to 36:268/288 of 4gieA
- active site: D55 (= D27), Y60 (= Y32), K85 (= K57), H118 (= H90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D55 (= D27), Y60 (= Y32), H118 (= H90), W119 (= W91), N148 (= N120), Q169 (= Q138), W195 (≠ Y166), S196 (≠ C167), P197 (= P168), L198 (= L169), S200 (vs. gap), L207 (= L175), A224 (= A193), I239 (= I209), P240 (= P210), K241 (= K211), S242 (≠ A212), R247 (≠ H217), E250 (≠ L220), N251 (= N221)
Sites not aligning to the query:
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
37% identity, 92% coverage: 6:238/253 of query aligns to 29:258/275 of 3d3fA
- active site: D48 (= D27), Y53 (= Y32), K78 (= K57), H111 (= H90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D48 (= D27), Y53 (= Y32), H111 (= H90), S140 (= S119), N141 (= N120), Q162 (= Q138), W188 (≠ Y166), S189 (≠ C167), P190 (= P168), L191 (= L169), Q193 (= Q171), L197 (= L176), I229 (= I209), K231 (= K211), S232 (≠ A212), K234 (≠ A214), R237 (≠ H217), E240 (≠ L220), N241 (= N221)
Sites not aligning to the query:
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
30% identity, 96% coverage: 1:242/253 of query aligns to 21:278/287 of 3v0sA
- active site: D45 (= D27), Y50 (= Y32), G87 (= G67), H119 (= H90)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (≠ C167), P199 (= P168), I200 (≠ L169), G201 (≠ A170), L204 (vs. gap), P246 (= P210), G247 (≠ K211), T248 (≠ A212), T249 (≠ V213), N253 (≠ H217), N256 (≠ L220), N257 (= N221)
3b3dA B.Subtilis ytbe (see paper)
36% identity, 90% coverage: 12:238/253 of query aligns to 34:263/280 of 3b3dA
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
33% identity, 91% coverage: 10:238/253 of query aligns to 31:257/276 of Q9GV41
Sites not aligning to the query:
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
33% identity, 91% coverage: 10:238/253 of query aligns to 36:262/281 of 1vbjA
- active site: D52 (= D27), Y57 (= Y32), K82 (= K57), H115 (= H90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D52 (= D27), Y57 (= Y32), H115 (= H90), N145 (= N120), Q166 (= Q138), W192 (≠ Y166), S193 (≠ C167), P194 (= P168), L195 (= L169), Q197 (= Q171), G198 (= G173), V201 (≠ L176), A218 (= A193), I233 (= I209), K235 (= K211), S236 (≠ A212), G237 (≠ V213), R241 (≠ H217), E244 (≠ L220), N245 (= N221)
Sites not aligning to the query:
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
34% identity, 86% coverage: 22:238/253 of query aligns to 43:266/283 of 4g5dA
- active site: D48 (= D27), Y53 (= Y32), K78 (= K57), H111 (= H90)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D48 (= D27), Y53 (= Y32), H111 (= H90), S148 (= S119), N149 (= N120), Q170 (= Q138), W196 (≠ Y166), S197 (≠ C167), P198 (= P168), L199 (= L169), Q201 (= Q171), G202 (= G173), L205 (= L176), I237 (= I209), P238 (= P210), K239 (= K211), S240 (≠ A212), V241 (= V213), H242 (≠ A214), R245 (≠ H217), E248 (≠ L220), N249 (= N221)
Sites not aligning to the query:
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 89% coverage: 14:238/253 of query aligns to 40:265/283 of A0QV09
- G196 (≠ C167) binding
- L198 (= L169) binding
- V200 (≠ A172) binding
- I236 (= I209) binding
- R238 (≠ K211) binding
- S239 (≠ A212) binding
- A240 (≠ V213) binding
- R244 (≠ H217) binding
- S247 (≠ L220) binding
- N248 (= N221) binding
Sites not aligning to the query:
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
33% identity, 89% coverage: 14:238/253 of query aligns to 31:256/274 of 2wzmA
- active site: D44 (= D27), Y49 (= Y32), K74 (= K57), H107 (= H90)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y166), G187 (≠ C167), P188 (= P168), L189 (= L169), G190 (≠ A170), V191 (≠ A172), G192 (= G173), L195 (= L176), A212 (= A193), I227 (= I209), R229 (≠ K211), S230 (≠ A212), R235 (≠ H217), N239 (= N221)
Sites not aligning to the query:
P51635 Aldo-keto reductase family 1 member A1; 3-DG-reducing enzyme; Alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; Glucuronate reductase; Glucuronolactone reductase; EC 1.1.1.2; EC 1.1.1.372; EC 1.1.1.54; EC 1.1.1.19; EC 1.1.1.20 from Rattus norvegicus (Rat) (see paper)
30% identity, 89% coverage: 13:238/253 of query aligns to 31:290/325 of P51635
- K34 (≠ Q16) Not glycated
- K61 (vs. gap) Not glycated
- K68 (≠ R48) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K80 (= K57) Not glycated
- K85 (≠ N62) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K97 (≠ R74) Not glycated
- K127 (vs. gap) Not glycated
- K134 (vs. gap) Not glycated
- K141 (≠ E98) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K145 (≠ E102) Not glycated
- K153 (≠ Q110) modified: carbohydrate, N-linked (Glc) (glycation) lysine
- K157 (= K114) Not glycated
- K240 (≠ R187) Not glycated
- K257 (≠ D204) Not glycated
- K263 (= K211) Not glycated
- K287 (≠ R235) Not glycated
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
- 13 Not glycated
- 23 modified: carbohydrate, N-linked (Glc) (glycation) lysine
- 30 Not glycated
- 294 Not glycated
- 308 Not glycated
1vp5A Crystal structure of 2,5-diketo-d-gluconic acid reductase (tm1009) from thermotoga maritima at 2.40 a resolution
33% identity, 92% coverage: 5:237/253 of query aligns to 24:258/284 of 1vp5A
- active site: D44 (= D27), Y49 (= Y32), K78 (= K57), H111 (= H90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D44 (= D27), Y49 (= Y32), N140 (= N120), Q161 (= Q138), W187 (≠ Y166), G188 (≠ C167), P189 (= P168), F190 (≠ L169), E192 (≠ Q171), F198 (≠ L176), A215 (= A193), I230 (= I209), K232 (= K211), T233 (≠ A212), V234 (= V213), R238 (≠ H217), E241 (≠ L220), N242 (= N221)
Sites not aligning to the query:
Query Sequence
>PP_3120 FitnessBrowser__Putida:PP_3120
MGEDPGRKAAEVAALQQGIELGLNLIDTAEMYAEGGAEEVVGQAIAGRRDRVFLVSKVYP
HNASLRGMAAACERSLTRLGTDCIDLYLLHWRGQHPLEETVEGFERLREQGKIKRWGVSN
FDVDDLRELHNPDCATNQVLYNPAQRGIEFDLLPWCGKRGLPTMAYCPLAQAGRLLQHPV
LAEIAERHGATPAQVCLAWVTRDDGVIAIPKAVAPEHVRLNAAAGALTLTGEDLRAIDRA
FPAPTRKQRLAMV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory