Comparing PP_3122 FitnessBrowser__Putida:PP_3122 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
59% identity, 95% coverage: 11:231/232 of query aligns to 43:285/520 of Q29551
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
59% identity, 95% coverage: 11:231/232 of query aligns to 4:246/462 of 3oxoE
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
59% identity, 95% coverage: 11:231/232 of query aligns to 4:246/468 of 1o9lA
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
59% identity, 95% coverage: 11:231/232 of query aligns to 4:246/466 of 3k6mC
Sites not aligning to the query:
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
48% identity, 98% coverage: 3:230/232 of query aligns to 1:246/459 of 8i3yA
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
48% identity, 98% coverage: 3:230/232 of query aligns to 1:246/467 of 8i40A
Sites not aligning to the query:
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
48% identity, 98% coverage: 3:230/232 of query aligns to 1:246/471 of 8i3yD
1k6dB Crystal structure of acetate coa-transferase alpha subunit (see paper)
40% identity, 93% coverage: 4:218/232 of query aligns to 1:215/219 of 1k6dB
2ahvA Crystal structure of acyl-coa transferase from e. Coli o157:h7 (ydif)- thioester complex with coa- 1 (see paper)
25% identity, 50% coverage: 102:218/232 of query aligns to 114:249/512 of 2ahvA
Sites not aligning to the query:
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
26% identity, 83% coverage: 5:197/232 of query aligns to 6:210/296 of Q0S7P9
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
26% identity, 83% coverage: 5:197/232 of query aligns to 5:209/295 of 6co9A
>PP_3122 FitnessBrowser__Putida:PP_3122
MAGLDKRVATYEQALEGLTDNMTVLAGGFGLCGIPENLISEIKRRGVKGLTVVSNNCGVD
GFGLGVLLEDRQIRKMIASYVGENAEFERQLLSGELEVELTPQGTLAEKMRAGGAGIPAF
YTATGYGTPVADGKEVREFKGRKYILEESITGDFAIVKGWKADHYGNVVYRNTAQNFNPL
AATAGKITVVEVEEIVEPGVLLPSEIHTPGIYVDRVIVGTFEKRIEKRTVKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory