SitesBLAST
Comparing PP_3146 FitnessBrowser__Putida:PP_3146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 85% coverage: 31:396/431 of query aligns to 25:374/383 of 5i39A
- active site: F66 (≠ N72), Q69 (= Q75), A70 (≠ L76), Q248 (≠ S258), P267 (≠ C282)
- binding flavin-adenine dinucleotide: V30 (≠ I36), G31 (= G37), G33 (= G39), I34 (≠ L40), L35 (≠ T41), V53 (≠ L59), E54 (= E60), K55 (≠ A61), Q62 (≠ A68), S63 (= S69), F66 (≠ N72), Y67 (≠ G73), Q69 (= Q75), A196 (≠ P210), A197 (≠ V211), G226 (vs. gap), G227 (= G237), W229 (≠ N239), Q248 (≠ S258), Q250 (≠ V260), G321 (= G341), M323 (≠ I343), T348 (≠ S369), G349 (= G370), W350 (≠ H371), G351 (= G372), M352 (≠ L373), T353 (≠ N374)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
23% identity, 81% coverage: 46:393/431 of query aligns to 20:357/374 of 1y56B
- active site: F44 (≠ G70), G47 (= G73), T48 (≠ R78), H224 (vs. gap), P239 (≠ S273), G305 (= G341), M338 (≠ N374)
- binding flavin-adenine dinucleotide: I33 (≠ L59), E34 (= E60), K35 (≠ A61), S42 (≠ A68), T43 (≠ S69), R45 (= R71), C46 (≠ N72), G47 (= G73), G49 (= G79), E170 (≠ P210), V171 (= V211), T200 (≠ C238), N201 (= N239), W203 (≠ H241), G305 (= G341), Y306 (≠ M342), Y307 (≠ I343), G334 (= G370), H335 (= H371), G336 (= G372), F337 (≠ L373), M338 (≠ N374)
- binding flavin mononucleotide: F44 (≠ G70), R45 (= R71), I260 (vs. gap), R301 (≠ Y337), W303 (= W339)
Sites not aligning to the query:
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
27% identity, 48% coverage: 31:236/431 of query aligns to 17:216/433 of 5hxwA
- active site: F58 (≠ N72), Q61 (= Q75), A62 (≠ L76)
- binding flavin-adenine dinucleotide: V22 (≠ I36), G23 (= G37), G25 (= G39), I26 (≠ L40), L27 (≠ T41), E46 (= E60), K47 (≠ A61), E53 (≠ G67), Q54 (≠ A68), S55 (= S69), R57 (= R71), F58 (≠ N72), Y59 (≠ G73), G60 (= G74), Q61 (= Q75), A188 (≠ P210), A189 (≠ V211)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 218, 219, 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 63% coverage: 31:302/431 of query aligns to 43:303/857 of Q63342
- CV 52:53 (≠ LT 40:41) binding
- EK 73:74 (≠ EA 60:61) binding
- 80:88 (vs. 67:75, 22% identical) binding
- H84 (≠ R71) modified: Tele-8alpha-FAD histidine
- V212 (= V211) binding
- W244 (≠ H241) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
26% identity, 63% coverage: 31:302/431 of query aligns to 6:266/824 of 4pabB
- active site: T53 (≠ S85), E102 (≠ A139), H226 (≠ S258), Y255 (= Y290)
- binding flavin-adenine dinucleotide: I11 (= I36), G12 (= G37), G14 (= G39), C15 (≠ L40), V16 (≠ T41), L35 (= L59), E36 (= E60), K37 (≠ A61), G43 (= G67), S44 (≠ A68), T45 (≠ S69), H47 (≠ R71), A48 (≠ N72), A49 (≠ G73), G50 (= G74), L51 (≠ Q75), V175 (= V211), A204 (≠ C238), G205 (≠ N239), W207 (≠ H241), H226 (≠ S258), Y228 (≠ V260)
Sites not aligning to the query:
- active site: 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
26% identity, 98% coverage: 8:431/431 of query aligns to 10:419/824 of Q8GAI3
- W66 (≠ G70) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R71) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Query Sequence
>PP_3146 FitnessBrowser__Putida:PP_3146
MSFNTQHTASYYAATARDAAPYPSLDSELTADVCVIGGGLTGVNTALELAERGLSVVLLE
ARRIGWGASGRNGGQLIRGIGHDVSGFARHVGQDGVRYLKQAGIDSVELVAERIARYGIA
CDLRWGFCELANTAAQFAAFKEEQDDLAALGYRHETRLVSAGQLNEIVASDQYAGGLVDM
GSGHLHPLDLVQGEARAAHSLGVRIFEQSPVLRIEHGPRLTLHTARGKVRASSLVLGCNA
HLDELEPRLSGKVLPAGSYVVATEPLPEALASSLIPQNMALCDQKVGLDYYRLTADRRLL
FGGACHYSGRHPKDIAAYMRPKVLKVFPQLANVRIDYQWGGMIGITANRFPQVGRLNQHP
NVYYAQGYSGHGLNVTHWTAKLLAESIALGHSHGLDVFSAVPHLTFPGGKALRSPLLALG
MLWYRLREALG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory