Comparing PP_3157 FitnessBrowser__Putida:PP_3157 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 98% coverage: 3:259/263 of query aligns to 78:343/346 of Q6NPM8
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
43% identity, 97% coverage: 6:260/263 of query aligns to 1:259/260 of 5eq9B
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
44% identity, 97% coverage: 7:260/263 of query aligns to 1:258/259 of 5eq8A
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
43% identity, 97% coverage: 6:260/263 of query aligns to 3:256/257 of 5t3jA
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
33% identity, 82% coverage: 46:261/263 of query aligns to 41:264/266 of Q9K4B1
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 81% coverage: 46:259/263 of query aligns to 39:257/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
33% identity, 81% coverage: 46:259/263 of query aligns to 37:255/256 of 5zonA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 81% coverage: 46:259/263 of query aligns to 36:254/255 of 5yhtA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 88% coverage: 30:260/263 of query aligns to 29:267/271 of Q9M8S8
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
30% identity, 83% coverage: 45:263/263 of query aligns to 42:265/270 of 6ib8B
6tqoT Rrn anti-termination complex (see paper)
30% identity, 83% coverage: 45:263/263 of query aligns to 30:253/255 of 6tqoT
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 83% coverage: 45:263/263 of query aligns to 38:261/267 of P0ADG4
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 83% coverage: 45:263/263 of query aligns to 38:261/262 of 2qflA
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
27% identity, 84% coverage: 14:235/263 of query aligns to 16:251/285 of Q19420
2p3nA Thermotoga maritima impase tm1415 (see paper)
28% identity, 78% coverage: 35:238/263 of query aligns to 27:225/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 78% coverage: 35:238/263 of query aligns to 27:225/256 of O33832
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
29% identity, 83% coverage: 45:261/263 of query aligns to 34:259/259 of 2cziA
6b63A Impase (af2372) with 25 mm asp
27% identity, 82% coverage: 46:260/263 of query aligns to 41:252/252 of 6b63A
6b60A Impase (af2372) with 25 mm glutamate
27% identity, 82% coverage: 46:260/263 of query aligns to 41:252/252 of 6b60A
Sites not aligning to the query:
6b5zA Impase (af2372) with 25 mm asp
27% identity, 82% coverage: 46:260/263 of query aligns to 41:252/252 of 6b5zA
Sites not aligning to the query:
>PP_3157 FitnessBrowser__Putida:PP_3157
MSLSAEQIVEYRAFAEQLADAAAAAIAPYFRASLDVEDKGGRLYDPVTVADKAAEDAMRE
LIQARYPEHGILGEEAGIAVGSSPLTWVLDPIDGTRAFITGLPLWGTLIALNDGARPVLG
VMNQPFTGERFVGTPAGAWRSGTPLKTRACADLSAATLMCTTPDMFDTAERKAAFEAVAG
KARLMRYGGDCYAYCMLASGFVDVIVEASLQPYDVQALMPIIEGAGGVITAWDGSSAQDG
GCVVACGDPVLHAQVLEMLRHAM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory