Comparing PP_3166 FitnessBrowser__Putida:PP_3166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
77% identity, 99% coverage: 3:303/304 of query aligns to 1:308/309 of 2azqA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
52% identity, 98% coverage: 1:299/304 of query aligns to 1:308/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
52% identity, 98% coverage: 3:299/304 of query aligns to 1:306/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
52% identity, 98% coverage: 3:299/304 of query aligns to 1:306/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
52% identity, 98% coverage: 3:299/304 of query aligns to 1:306/309 of 1dlmA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
50% identity, 100% coverage: 2:304/304 of query aligns to 1:310/310 of 5umhB
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
59% identity, 77% coverage: 29:262/304 of query aligns to 28:261/309 of 2xsrA
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
49% identity, 98% coverage: 3:300/304 of query aligns to 1:305/307 of 5td3A
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
49% identity, 99% coverage: 1:300/304 of query aligns to 5:309/312 of 5vxtB
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
33% identity, 81% coverage: 16:260/304 of query aligns to 10:251/286 of 3n9tA
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
31% identity, 84% coverage: 29:283/304 of query aligns to 4:250/253 of 2boyA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3hjsA
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3hjqA
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3hhyA
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 54:256/256 of 3hhxA
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 56:258/258 of 3hgiA
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
34% identity, 67% coverage: 83:286/304 of query aligns to 55:257/257 of 3hj8A
>PP_3166 FitnessBrowser__Putida:PP_3166
MTVNISHTAEVQQFFEQAAGFCNAAGNPRLKRIVQRLLQDTARLIEDLDISEDEFWHAVD
YLNRLGGRGEAGLLVAGLGIEHFLDLLQDAKDQEAGRVGGTPRTIEGPLYVAGAPIAQGE
VRMDDGSEEGVATVMFLEGQVLDPHGRPLPGATVDLWHANTRGTYSFFDQSQSAYNLRRR
IVTDAQGRYRARSIVPSGYGCDPQGPTQECLDLLGRHGQRPAHVHFFISAPGYRHLTTQI
NLSGDKYLWDDFAYATRDGLVGEVVFVEGPDGRHAELKFDFQLQQAQGGADEQRSGRPRA
LQEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory