SitesBLAST
Comparing PP_3174 FitnessBrowser__Putida:PP_3174 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hw0A The structure of akr6d1
38% identity, 93% coverage: 1:312/336 of query aligns to 1:319/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (vs. gap), Q27 (= Q26), D49 (= D48), Y54 (= Y53), R123 (= R121), S152 (= S150), Q178 (= Q176), W207 (≠ F204), S208 (= S205), P209 (= P206), L210 (= L207), S212 (≠ R209), K218 (= K215), S227 (= S226), R228 (= R227), I285 (= I280), G287 (= G282), S289 (≠ R284), Q293 (= Q288), D296 (≠ T291), N297 (≠ Y292)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
40% identity, 86% coverage: 1:288/336 of query aligns to 1:292/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), D49 (= D48), Y54 (= Y53), S151 (= S150), Y204 (≠ F204), F205 (≠ S205), L207 (= L207), Q209 (≠ R209), G210 (= G210), T213 (≠ S213), K215 (= K215), R227 (= R227), V284 (≠ I280), G286 (= G282), Q292 (= Q288)
Sites not aligning to the query:
8jwmB Crystal structure of akrtyl-NADP-tylosin complex (see paper)
40% identity, 93% coverage: 1:313/336 of query aligns to 1:313/331 of 8jwmB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D48), Y53 (= Y53), N161 (= N151), Q186 (= Q176), W214 (≠ F204), S215 (= S205), P216 (= P206), L217 (= L207), G219 (≠ R209), G220 (= G210), R235 (= R227), R236 (vs. gap), A237 (vs. gap), I287 (= I280), G289 (= G282), R291 (= R284), Q295 (= Q288), S298 (≠ A298)
- binding tylosin: Y53 (= Y53), W55 (vs. gap), H130 (= H120), C192 (≠ V182), E193 (≠ N183), R195 (≠ Q185), G240 (= G229), R241 (= R230), Q250 (≠ E239), E253 (≠ Q242), Q254 (= Q250), R257 (≠ T253)
Sites not aligning to the query:
8jwkH The second purified state crystal structure of akrtyl (see paper)
39% identity, 93% coverage: 1:313/336 of query aligns to 1:289/307 of 8jwkH
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D48), Y53 (= Y53), H129 (= H120), N160 (= N151), Q185 (= Q176), W213 (≠ F204), S214 (= S205), P215 (= P206), L216 (= L207), G218 (≠ R209), I263 (= I280), G265 (= G282), R267 (= R284), Q271 (= Q288), S274 (≠ A298)
8jwkD The second purified state crystal structure of akrtyl (see paper)
39% identity, 93% coverage: 1:313/336 of query aligns to 1:296/314 of 8jwkD
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D48), Y53 (= Y53), H130 (= H120), Q186 (= Q176), W214 (≠ F204), S215 (= S205), P216 (= P206), L217 (= L207), I270 (= I280), G272 (= G282), R274 (= R284), Q278 (= Q288), S281 (≠ A298)
8jwoL Crystal structure of akrtyl-tylosin complex (see paper)
39% identity, 93% coverage: 1:313/336 of query aligns to 1:293/311 of 8jwoL
Sites not aligning to the query:
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
35% identity, 93% coverage: 2:312/336 of query aligns to 38:355/367 of P62483
- T56 (≠ S20) binding
- W57 (vs. gap) binding
- Q63 (= Q26) binding
- D85 (= D48) binding
- Y90 (= Y53) mutation to F: Abolishes enzyme activity, but has no effect on NADPH binding.
- S112 (≠ D72) modified: Phosphoserine
- N158 (≠ H120) binding
- S188 (= S150) binding
- R189 (≠ N151) binding
- Q214 (= Q176) binding
- W243 (≠ F204) binding
- S244 (= S205) binding
- P245 (= P206) binding
- L246 (= L207) binding
- A247 (= A208) binding
- C248 (≠ R209) binding
- K254 (= K215) binding
- Y262 (≠ E223) binding
- R264 (vs. gap) binding
- G323 (= G282) binding
- S325 (≠ R284) binding
- Q329 (= Q288) binding
- E332 (≠ T291) binding
- N333 (≠ Y292) binding
Sites not aligning to the query:
- 9 modified: Phosphoserine; S→A: Impairs interaction with MAPRE1 and association with microtubules.
- 20 modified: Phosphoserine; S→A: No effect on interaction with MAPRE1 and association with microtubules.
- 31 S→A: Impairs interaction with MAPRE1 and association with microtubules.
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
35% identity, 93% coverage: 2:312/336 of query aligns to 38:355/367 of P62482
- Y90 (= Y53) mutation to F: No detectable phenotype.
- S112 (≠ D72) modified: Phosphoserine
Sites not aligning to the query:
- 20 modified: Phosphoserine
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
35% identity, 93% coverage: 2:312/336 of query aligns to 4:321/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G19), W23 (vs. gap), Q29 (= Q26), D51 (= D48), Y56 (= Y53), K84 (= K78), S154 (= S150), Q180 (= Q176), W209 (≠ F204), S210 (= S205), P211 (= P206), L212 (= L207), A213 (= A208), C214 (≠ R209), G215 (= G210), K220 (= K215), R230 (vs. gap), L287 (≠ I280), L288 (≠ V281), G289 (= G282), S291 (≠ R284), Q295 (= Q288), E298 (≠ T291), N299 (≠ Y292)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (vs. gap), V55 (= V52), Y56 (= Y53), W87 (≠ F81), N124 (≠ H120), R155 (≠ N151), I174 (≠ P170), I177 (= I173), I202 (vs. gap)
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
35% identity, 93% coverage: 2:312/336 of query aligns to 3:320/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), W22 (vs. gap), Q28 (= Q26), D50 (= D48), Y55 (= Y53), S153 (= S150), R154 (≠ N151), Q179 (= Q176), W208 (≠ F204), S209 (= S205), P210 (= P206), L211 (= L207), C213 (≠ R209), G214 (= G210), S217 (= S213), K219 (= K215), S228 (≠ A224), R229 (vs. gap), L286 (≠ I280), G288 (= G282), S290 (≠ R284), Q294 (= Q288), E297 (≠ T291), N298 (≠ Y292)
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
35% identity, 93% coverage: 2:312/336 of query aligns to 38:355/367 of Q13303
- T56 (≠ S20) binding
- W57 (vs. gap) binding
- Q63 (= Q26) binding
- D85 (= D48) binding
- Y90 (= Y53) mutation to F: No effect on its activity in promoting KCNA4 channel closure.
- S112 (≠ D72) modified: Phosphoserine
- S188 (= S150) binding
- R189 (≠ N151) binding
- Q214 (= Q176) binding
- W243 (≠ F204) binding
- S244 (= S205) binding
- P245 (= P206) binding
- L246 (= L207) binding
- A247 (= A208) binding
- C248 (≠ R209) binding
- K254 (= K215) binding
- R264 (vs. gap) binding
- S325 (≠ R284) binding
- Q329 (= Q288) binding
- E332 (≠ T291) binding
- N333 (≠ Y292) binding
Sites not aligning to the query:
- 31 modified: Phosphoserine
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
35% identity, 93% coverage: 2:312/336 of query aligns to 5:322/328 of 7wf3C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G19), R156 (≠ N151), W210 (≠ F204), S211 (= S205), P212 (= P206), L213 (= L207), C215 (≠ R209), K221 (= K215), R231 (vs. gap), Q296 (= Q288), E299 (≠ T291), N300 (≠ Y292)
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
35% identity, 93% coverage: 1:312/336 of query aligns to 71:389/401 of P63144
- K152 (= K78) mutation to M: Loss of enzyme activity.
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
35% identity, 93% coverage: 1:312/336 of query aligns to 89:407/419 of Q14722
- Y307 (= Y216) mutation to F: Reduces affinity for NADPH.
- R316 (= R227) mutation to E: Nearly abolishes NADPH binding.
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
38% identity, 86% coverage: 1:288/336 of query aligns to 1:268/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), Y50 (= Y53), H117 (= H120), S147 (= S150), Y200 (≠ F204), F201 (≠ S205), L203 (= L207), Q205 (≠ R209), T209 (≠ S213), Q268 (= Q288)
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 93% coverage: 2:314/336 of query aligns to 8:344/351 of Q9P7U2
- S113 (vs. gap) modified: Phosphoserine
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
33% identity, 94% coverage: 1:315/336 of query aligns to 11:324/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G19), W31 (vs. gap), D59 (= D48), Y64 (= Y53), H136 (= H120), Q191 (= Q176), F220 (= F204), T221 (≠ S205), P222 (= P206), L223 (= L207), Q225 (≠ R209), G226 (= G210), K231 (= K215), R241 (= R234), R244 (≠ E237), L288 (≠ I280), G290 (= G282), S292 (≠ R284), Q296 (= Q288), E299 (≠ T291), N300 (≠ Y292)
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
31% identity, 94% coverage: 1:315/336 of query aligns to 12:311/315 of 3n6qD
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
32% identity, 93% coverage: 1:312/336 of query aligns to 13:313/315 of 5t79A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G31 (= G19), W33 (vs. gap), Y66 (= Y53), H138 (= H120), N169 (= N151), Q193 (= Q176), F221 (= F204), S222 (= S205), L224 (= L207), G226 (≠ R209), T230 (≠ S213), R232 (≠ K215), S263 (≠ V263), L280 (≠ I280), G282 (= G282), S284 (≠ R284), Q288 (= Q288)
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
31% identity, 93% coverage: 1:312/336 of query aligns to 12:308/312 of 3erpA
Query Sequence
>PP_3174 FitnessBrowser__Putida:PP_3174
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRSEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNAVDATLTRMGMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEVCHVAERLGVPRPIVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPEAGSRAGRQDKRIMEVEW
RQESLTIARQIQTYAEAKGVGIVEFAIAWVLNNQWVSSAIVGPRTEEQWDTYGGALAAKI
TAEDEAFIDSLVTPGHASTSGFNDVAHYVSGRLARS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory