SitesBLAST
Comparing PP_3175 FitnessBrowser__Putida:PP_3175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
32% identity, 71% coverage: 120:478/506 of query aligns to 7:366/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G124), V12 (≠ A125), G13 (≠ A126), D35 (≠ Q148), E36 (= E149), R43 (= R156), P44 (≠ T157), S47 (= S160), K48 (= K161), V80 (= V194), T107 (= T221), G108 (= G222), R128 (= R242), G274 (= G387), D275 (= D388), T291 (≠ H403), Y292 (≠ W404), S319 (≠ F431), W320 (= W432)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
32% identity, 71% coverage: 120:478/506 of query aligns to 6:365/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G124), V11 (≠ A125), G12 (≠ A126), D34 (≠ Q148), E35 (= E149), R42 (= R156), P43 (≠ T157), K47 (= K161), E78 (≠ K193), V79 (= V194), T106 (= T221), G107 (= G222), G273 (= G387), D274 (= D388), T290 (≠ H403), Y291 (≠ W404), W319 (= W432)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ L226), G149 (= G264), L152 (≠ F267), I153 (= I268), E156 (= E271), E172 (≠ S287), A173 (≠ R288), R180 (= R295), V236 (≠ T351), G237 (= G352), A238 (≠ V353), E289 (= E402), W319 (= W432), T320 (= T433)
6tukB Crystal structure of fdr9 (see paper)
32% identity, 65% coverage: 118:445/506 of query aligns to 4:325/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V121), G8 (= G122), G9 (≠ A123), G10 (= G124), A12 (= A126), A34 (≠ Q148), E35 (= E149), R42 (= R156), P43 (≠ T157), K47 (= K161), A75 (≠ V194), A76 (≠ R195), T102 (= T221), G103 (= G222), V118 (≠ L241), R119 (= R242), G259 (= G387), D260 (= D388), H277 (= H403), W278 (= W404), F311 (= F431), W312 (= W432)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
29% identity, 70% coverage: 137:489/506 of query aligns to 25:393/409 of 3lxdA
- active site: R44 (= R156), P45 (≠ T157), N302 (≠ Q408)
- binding flavin-adenine dinucleotide: R36 (≠ Q148), E37 (= E149), R44 (= R156), P45 (≠ T157), S48 (= S160), K49 (= K161), E81 (≠ K193), V82 (= V194), T109 (= T221), I157 (= I268), G278 (= G387), D279 (= D388), S297 (≠ H403), V298 (≠ W404), F325 (= F431), W326 (= W432)
Sites not aligning to the query:
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
28% identity, 69% coverage: 119:466/506 of query aligns to 5:355/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G122), G10 (= G124), H11 (≠ A125), A12 (= A126), D34 (≠ Q148), E35 (= E149), R42 (= R156), P43 (≠ T157), S46 (= S160), K47 (= K161), R78 (≠ K193), M79 (≠ V194), T106 (= T221), R127 (= R242), I153 (= I268), D275 (= D388), S292 (≠ H403), V293 (≠ W404), W321 (= W432)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
31% identity, 70% coverage: 119:471/506 of query aligns to 7:366/401 of 4h4uA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: G12 (= G124), A14 (= A126), D36 (≠ Q148), R44 (= R156), P45 (≠ T157), A78 (≠ V194), T105 (= T221), G106 (= G222), L125 (= L241), R126 (= R242), I152 (= I268), E155 (= E271), G268 (= G387), D269 (= D388), E285 (= E402), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F267), I152 (= I268), E171 (≠ S287), R172 (= R288), Q173 (≠ H289), G230 (= G350), I231 (≠ T351), G232 (= G352), I284 (= I401), E285 (= E402), Y315 (≠ F431)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
31% identity, 70% coverage: 119:471/506 of query aligns to 6:365/399 of 4h4wA
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ Q148), R43 (= R156), P44 (≠ T157), A77 (≠ V194), T104 (= T221), G105 (= G222), R125 (= R242), I151 (= I268), E154 (= E271), G267 (= G387), D268 (= D388), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (≠ D265), I151 (= I268), R171 (= R288), S177 (≠ A294), R178 (= R295), G229 (= G350), I230 (≠ T351), G231 (= G352)
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
35% identity, 53% coverage: 162:428/506 of query aligns to 48:323/443 of 6rvhA
- active site: E53 (≠ Q167), E58 (= E172), Y159 (≠ F267), E163 (= E271)
- binding coenzyme a: R63 (≠ L177), N303 (≠ Q408), R307 (≠ V412)
- binding flavin-adenine dinucleotide: V81 (= V194), T113 (= T221), G114 (= G222), R134 (= R242), Y159 (≠ F267), G280 (= G387), D281 (= D388), P297 (≠ E402), L298 (≠ H403), G299 (≠ W404)
Sites not aligning to the query:
- active site: 39, 44, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
35% identity, 53% coverage: 162:428/506 of query aligns to 48:323/443 of 6rvbA
- active site: E53 (≠ Q167), E58 (= E172), Y159 (≠ F267), E163 (= E271)
- binding coenzyme a: R63 (≠ L177), N303 (≠ Q408), R307 (≠ V412)
- binding flavin-adenine dinucleotide: E80 (≠ K193), V81 (= V194), T113 (= T221), G114 (= G222), L133 (= L241), R134 (= R242), I160 (= I268), G280 (= G387), D281 (= D388), L298 (≠ H403), G299 (≠ W404)
- binding nicotinamide-adenine-dinucleotide: G156 (= G264), G158 (= G266), Y159 (≠ F267), I160 (= I268), E179 (≠ S287), A180 (≠ R288), A240 (≠ G350), T241 (= T351), G242 (= G352), P297 (≠ E402)
Sites not aligning to the query:
- active site: 39, 44, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 424, 425
- binding nicotinamide-adenine-dinucleotide: 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
35% identity, 53% coverage: 162:428/506 of query aligns to 48:323/443 of 6ruzA
- active site: E53 (≠ Q167), E58 (= E172), Y159 (≠ F267), E163 (= E271)
- binding coenzyme a: R63 (≠ L177), N303 (≠ Q408), R307 (≠ V412)
- binding flavin-adenine dinucleotide: E80 (≠ K193), V81 (= V194), T113 (= T221), G114 (= G222), A115 (≠ G223), L133 (= L241), R134 (= R242), Y159 (≠ F267), G280 (= G387), D281 (= D388), P297 (≠ E402), L298 (≠ H403), G299 (≠ W404)
Sites not aligning to the query:
- active site: 39, 44, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 424, 425
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
30% identity, 70% coverage: 119:471/506 of query aligns to 7:366/401 of 1f3pA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: A14 (= A126), V34 (≠ I146), D36 (≠ Q148), E37 (= E149), R44 (= R156), P45 (≠ T157), A78 (≠ V194), T105 (= T221), G106 (= G222), R126 (= R242), G268 (= G387), D269 (= D388), E285 (= E402), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding nicotinamide-adenine-dinucleotide: V147 (= V263), G148 (= G264), G150 (= G266), V151 (≠ F267), I152 (= I268), E155 (= E271), E171 (≠ S287), T172 (≠ R288), R179 (= R295), G230 (= G350), I231 (≠ T351), G232 (= G352), V233 (= V353), E285 (= E402), W316 (= W432), S317 (≠ T433)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
30% identity, 70% coverage: 119:471/506 of query aligns to 8:367/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G124), A15 (= A126), D37 (≠ Q148), E38 (= E149), R45 (= R156), P46 (≠ T157), K50 (= K161), A79 (≠ V194), T106 (= T221), G107 (= G222), R127 (= R242), I153 (= I268), G269 (= G387), D270 (= D388), E286 (= E402), T287 (≠ H403), W288 (= W404), A291 (= A407), W317 (= W432)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
30% identity, 70% coverage: 119:471/506 of query aligns to 7:366/402 of 2yvjA
- active site: L13 (≠ A125), R44 (= R156), P45 (≠ T157), Q291 (= Q408)
- binding flavin-adenine dinucleotide: G10 (= G122), G12 (= G124), G35 (≠ D147), D36 (≠ Q148), E37 (= E149), R44 (= R156), P45 (≠ T157), A78 (≠ V194), T105 (= T221), G106 (= G222), R126 (= R242), G268 (= G387), D269 (= D388), T286 (≠ H403), W287 (= W404), A290 (= A407), W316 (= W432)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (= V263), G148 (= G264), G149 (≠ D265), G150 (= G266), I152 (= I268), V170 (= V286), E171 (≠ S287), T172 (≠ R288), R179 (= R295), G230 (= G350), I231 (≠ T351), G232 (= G352), V233 (= V353), E285 (= E402)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
30% identity, 70% coverage: 119:471/506 of query aligns to 6:365/401 of 2gr2A
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding adenosine-5-diphosphoribose: R109 (≠ K224), V146 (= V263), G147 (= G264), G149 (= G266), V150 (≠ F267), I151 (= I268), E170 (≠ S287), T171 (≠ R288), R178 (= R295), G229 (= G350), I230 (≠ T351), G231 (= G352), E284 (= E402)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ Q148), E36 (= E149), R43 (= R156), P44 (≠ T157), K48 (= K161), A77 (≠ V194), T104 (= T221), G105 (= G222), R125 (= R242), G267 (= G387), D268 (= D388), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
30% identity, 70% coverage: 119:471/506 of query aligns to 6:365/401 of 2gr0A
- active site: L12 (≠ A125), R43 (= R156), P44 (≠ T157), Q290 (= Q408)
- binding adenosine-5'-diphosphate: V146 (= V263), G147 (= G264), G149 (= G266), I151 (= I268), E170 (≠ S287), T171 (≠ R288), R178 (= R295), G229 (= G350), I230 (≠ T351), G231 (= G352)
- binding flavin-adenine dinucleotide: G11 (= G124), A13 (= A126), D35 (≠ Q148), E36 (= E149), R43 (= R156), P44 (≠ T157), K48 (= K161), T76 (≠ K193), A77 (≠ V194), T104 (= T221), G105 (= G222), R125 (= R242), I151 (= I268), G267 (= G387), D268 (= D388), E284 (= E402), T285 (≠ H403), W286 (= W404), A289 (= A407), W315 (= W432)
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
32% identity, 61% coverage: 119:428/506 of query aligns to 4:318/424 of 8c0zE
Q9LK94 Monodehydroascorbate reductase 4, peroxisomal; AtMDAR4; EC 1.6.5.4 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 60% coverage: 141:444/506 of query aligns to 31:356/488 of Q9LK94
Sites not aligning to the query:
- 11 G→Q: In sdp2-2; loss of ascorbate recycling.
- 14 V→A: In sdp2-1; loss of ascorbate recycling.
- 386 G→Q: In sdp2-3; loss of ascorbate recycling.
- 483:488 mutation Missing: Loss of peroxisomal targeting.
- 488 mutation Missing: No effect on peroxisomal targeting.
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
29% identity, 71% coverage: 119:476/506 of query aligns to 7:373/422 of 1q1wA
- active site: L13 (≠ A125), L44 (≠ R156), P45 (≠ T157), L305 (≠ Q408)
- binding flavin-adenine dinucleotide: G10 (= G122), G12 (= G124), L13 (≠ A125), A14 (= A126), G35 (≠ D147), D36 (≠ Q148), L44 (≠ R156), P45 (≠ T157), K49 (= K161), V82 (= V194), A108 (= A220), T109 (= T221), G110 (= G222), R133 (= R242), I159 (= I268), D283 (= D388), S300 (≠ H403), V301 (≠ W404), W329 (= W432)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
29% identity, 71% coverage: 119:476/506 of query aligns to 8:374/422 of P16640
- A15 (= A126) binding
- D37 (≠ Q148) binding
- K50 (= K161) binding
- V83 (= V194) binding
- R134 (= R242) binding
- D284 (= D388) binding
- V302 (≠ W404) binding
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
30% identity, 42% coverage: 211:420/506 of query aligns to 106:321/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 332, 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
Query Sequence
>PP_3175 FitnessBrowser__Putida:PP_3175
MTQYAVARLAQLDEHRPLRVQAGSEELILVRQGEQVHAYQGNCPHAGAPLDEGVVCGGLL
VCPWHKATFAVDDGVVCEPPALADLRRYKAWIKGDEVWVDDQPLPATEPPRHSDARCFVV
VGAGAAGSAAVATLLAHGFAGRLVWIDQERQPAYDRTALSKFVIAGQMPPDEVPALLEAD
ALRKGQLERKYGKVRTLNSQKRQVTLADGQQIDYDACLLATGGKALRPDIPGADLPGVFT
LRSLEDAARLLDAAEPGQPVVIVGDGFIGLEAASALRKYGVQVHVVSRHEVPLARQLGER
IGRCIRALHERKGITFHGPTEVERIEGLDKVEAVQLTNGERLQTPLVLLGTGVRPATAFL
QGVPLGEDKSVRVDAEMRAADGLWAAGDIATFPLTGRPVRIEHWRLAQQHGVIAAANMLG
EQRRYADVPFFWTYQHGRTYEVLGHARDWNRIEFVGEPEKGDFVALQCVDERVEAVIAKG
YSDAMATLSQRLKRPLSLQEAWALIG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory