Comparing PP_3197 FitnessBrowser__Putida:PP_3197 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3b59A Crystal structure of the mn(ii)-bound glyoxalase from novosphingobium aromaticivorans
30% identity, 40% coverage: 152:277/313 of query aligns to 136:256/301 of 3b59A
1lkdA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2',6'-dicl dihydroxybiphenyl (dhb) (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/287 of 1lkdA
Sites not aligning to the query:
1lgtA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb) (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/287 of 1lgtA
1hanA Crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/287 of 1hanA
Sites not aligning to the query:
1knfA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 3-methyl catechol under anaerobic condition (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/288 of 1knfA
1kndA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with catechol under anaerobic condition (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/288 of 1kndA
1kmyA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition (see paper)
25% identity, 67% coverage: 73:282/313 of query aligns to 64:273/288 of 1kmyA
>PP_3197 FitnessBrowser__Putida:PP_3197
MNILGLDALVFGVDDIQACADCLRDYGLDAVQLDGDGGRFEALDGTSIIIRRGDDPGLPP
ALGPTPSLRETVYGVASSTDLAAIADELGRDREVRRDASGALHTFDDLGFAIAFQVTCRR
PFDAPADLTNAPGSAPQRPINQLGIAPDMPALPRTLSHVVYFVPDAAKGEAFYRDRLGFV
TTDSFIGVGPFMRTAAMDDHHCLFMIQTPPHMQGCEHFTFHMGSGTEVLLAGTRFQQQGW
TSFWGPGRHLLGSNWFWYFNSPLGCHIEYDADMDKHDDAWAARQAPMSADNSQLFLFASR
EKWAPSGPPAKQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory