SitesBLAST
Comparing PP_3211 FitnessBrowser__Putida:PP_3211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 74% coverage: 37:244/282 of query aligns to 28:229/378 of P69874
- F45 (= F54) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C63) mutation to T: Loss of ATPase activity and transport.
- L60 (= L69) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ W85) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V148) mutation to M: Loss of ATPase activity and transport.
- D172 (= D185) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
1g291 Malk (see paper)
39% identity, 69% coverage: 41:234/282 of query aligns to 18:213/372 of 1g291
- binding magnesium ion: D69 (≠ G92), E71 (≠ D94), K72 (≠ H95), K79 (vs. gap), D80 (≠ G101)
- binding pyrophosphate 2-: S38 (= S61), G39 (= G62), C40 (= C63), G41 (= G64), K42 (= K65), T43 (≠ S66), T44 (= T67)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
39% identity, 69% coverage: 41:235/282 of query aligns to 21:217/375 of 2d62A
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 74% coverage: 29:236/282 of query aligns to 6:209/363 of 8hprC
- binding adenosine-5'-triphosphate: Y12 (= Y35), S38 (= S61), G39 (= G62), G41 (= G64), K42 (= K65), S43 (= S66), Q82 (= Q109), Q133 (≠ E160), G136 (= G163), G137 (= G164), Q138 (≠ M165), H192 (= H219)
- binding magnesium ion: S43 (= S66), Q82 (= Q109)
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 74% coverage: 29:236/282 of query aligns to 6:209/362 of 8hprD
- binding adenosine-5'-triphosphate: Y12 (= Y35), S38 (= S61), C40 (= C63), G41 (= G64), K42 (= K65), S43 (= S66), T44 (= T67), Q82 (= Q109), R129 (≠ V156), Q133 (≠ E160), S135 (= S162), G136 (= G163), G137 (= G164), Q159 (≠ E186), H192 (= H219)
- binding magnesium ion: S43 (= S66), Q82 (= Q109)
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 73% coverage: 29:234/282 of query aligns to 7:208/393 of P9WQI3
- H193 (= H219) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
8hplC Lpqy-sugabc in state 1 (see paper)
37% identity, 73% coverage: 29:234/282 of query aligns to 6:205/384 of 8hplC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 72% coverage: 33:235/282 of query aligns to 14:203/353 of 1vciA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 69% coverage: 49:242/282 of query aligns to 49:242/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12, 39, 40, 41
7aheC Opua inhibited inward facing (see paper)
35% identity, 69% coverage: 49:242/282 of query aligns to 49:242/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
34% identity, 70% coverage: 47:242/282 of query aligns to 47:242/260 of 7ahdC
- binding adenosine-5'-triphosphate: S61 (= S61), G62 (= G62), G64 (= G64), K65 (= K65), S66 (= S66), T67 (= T67), Q111 (= Q109), K161 (≠ R159), Q162 (≠ E160), S164 (= S162), G166 (= G164), M167 (= M165), Q188 (≠ E186), H221 (= H219)
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
35% identity, 74% coverage: 26:234/282 of query aligns to 4:216/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
35% identity, 74% coverage: 26:234/282 of query aligns to 3:215/245 of 7tchB
- binding adenosine-5'-triphosphate: Y12 (= Y35), Q19 (vs. gap), V21 (≠ A41), S41 (= S61), G42 (= G62), S43 (≠ C63), K45 (= K65), T46 (≠ S66), E142 (= E160), G145 (= G163), G146 (= G164)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 21:211/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 21:211/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S61), G38 (= G62), C39 (= C63), G40 (= G64), K41 (= K65), S42 (= S66), T43 (= T67), Q81 (= Q109), R128 (≠ V156), A132 (≠ E160), S134 (= S162), G136 (= G164), Q137 (≠ M165), E158 (= E186), H191 (= H219)
- binding magnesium ion: S42 (= S66), Q81 (= Q109)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 21:211/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G62), C39 (= C63), G40 (= G64), K41 (= K65), S42 (= S66), T43 (= T67), R128 (≠ V156), S134 (= S162), Q137 (≠ M165)
- binding beryllium trifluoride ion: S37 (= S61), G38 (= G62), K41 (= K65), Q81 (= Q109), S134 (= S162), G136 (= G164), H191 (= H219)
- binding magnesium ion: S42 (= S66), Q81 (= Q109)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 21:211/371 of 3puwA
- binding adenosine-5'-diphosphate: G38 (= G62), C39 (= C63), G40 (= G64), K41 (= K65), S42 (= S66), T43 (= T67), R128 (≠ V156), A132 (≠ E160), S134 (= S162), Q137 (≠ M165)
- binding tetrafluoroaluminate ion: S37 (= S61), G38 (= G62), K41 (= K65), Q81 (= Q109), S134 (= S162), G135 (= G163), G136 (= G164), E158 (= E186), H191 (= H219)
- binding magnesium ion: S42 (= S66), Q81 (= Q109)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 21:211/371 of 3puvA
- binding adenosine-5'-diphosphate: G38 (= G62), C39 (= C63), G40 (= G64), K41 (= K65), S42 (= S66), T43 (= T67), R128 (≠ V156), A132 (≠ E160), S134 (= S162), Q137 (≠ M165)
- binding magnesium ion: S42 (= S66), Q81 (= Q109)
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
38% identity, 70% coverage: 45:241/282 of query aligns to 19:209/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S61), G36 (= G62), C37 (= C63), G38 (= G64), K39 (= K65), S40 (= S66), T41 (= T67), R126 (≠ V156), A130 (≠ E160), S132 (= S162), G134 (= G164), Q135 (≠ M165)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
38% identity, 70% coverage: 45:241/282 of query aligns to 22:212/371 of P68187
- A85 (≠ T112) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P133) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V141) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A144) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E146) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ G151) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G164) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D185) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
Query Sequence
>PP_3211 FitnessBrowser__Putida:PP_3211
MLMQTLSKADVQPQALPNTIGVDTPLFANQVEKTYSNGTHALSRVKLAIERGEFVSLLGP
SGCGKSTLLKMFAGLEQPSAGHVRWWGKDAPGTDHHAGTPGRSLAMVFQEATLMPWAKVH
DNVRLPLDLAGAPKAQSQLKVQAALELVGLGKFGDVYPRELSGGMQMRASIARALATEPN
LLLMDEPFGALDEFTRNKLDSDLRQLWLKRDLTVVFVTHSIFEAVYLSSRVIVMGARPGR
VIADVIIDGPLERDEAYRTSPAFIEQCAHLSRLLAQANGDPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory