Comparing PP_3274 FitnessBrowser__Putida:PP_3274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
29% identity, 84% coverage: 54:355/358 of query aligns to 55:322/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
29% identity, 84% coverage: 54:355/358 of query aligns to 54:321/321 of 2piaA
Sites not aligning to the query:
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
41% identity, 25% coverage: 265:352/358 of query aligns to 1:89/97 of 1rfkB
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
27% identity, 84% coverage: 55:355/358 of query aligns to 487:753/753 of 6laaA
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
27% identity, 68% coverage: 6:247/358 of query aligns to 102:333/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
27% identity, 68% coverage: 6:247/358 of query aligns to 101:332/333 of 5ogxA
Sites not aligning to the query:
3b2gA Leptolyngbya boryana ferredoxin (see paper)
39% identity, 24% coverage: 269:353/358 of query aligns to 5:90/98 of 3b2gA
6yacN Plant psi-ferredoxin supercomplex (see paper)
41% identity, 23% coverage: 271:352/358 of query aligns to 8:87/97 of 6yacN
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
38% identity, 25% coverage: 265:353/358 of query aligns to 1:89/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
38% identity, 25% coverage: 265:353/358 of query aligns to 2:90/98 of 6khi1
5h57A Ferredoxin iii from maize root (see paper)
43% identity, 22% coverage: 274:352/358 of query aligns to 11:88/97 of 5h57A
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
38% identity, 24% coverage: 269:353/358 of query aligns to 4:89/97 of 7s3dX
7ylrA Structure of a bacteria protein
29% identity, 80% coverage: 67:354/358 of query aligns to 75:326/326 of 7ylrA
Sites not aligning to the query:
6xtfD Crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor (see paper)
36% identity, 24% coverage: 265:349/358 of query aligns to 1:84/96 of 6xtfD
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
25% identity, 68% coverage: 2:246/358 of query aligns to 103:336/337 of 1krhA
Sites not aligning to the query:
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
38% identity, 23% coverage: 269:352/358 of query aligns to 6:90/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
38% identity, 23% coverage: 269:352/358 of query aligns to 5:89/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
38% identity, 23% coverage: 269:352/358 of query aligns to 5:89/98 of 1czpA
P27320 Ferredoxin-1; Ferredoxin I from Synechocystis sp. (strain PCC 6803 / Kazusa) (see 3 papers)
48% identity, 17% coverage: 289:349/358 of query aligns to 25:85/97 of P27320
Sites not aligning to the query:
5aukA Crystal structure of the ga-substituted ferredoxin (see paper)
48% identity, 17% coverage: 289:349/358 of query aligns to 24:84/96 of 5aukA
>PP_3274 FitnessBrowser__Putida:PP_3274
MSQFHSLTIKQVRNETRDAVSIAFDVPEHLQGQFRFTQGQYLVMRTQLDNEEVRRSYSIC
SAVQDGELRVAVKRVPGGRFSAFANEVLKAGQQLEVMPPSGSFFVPLDPARQGNYLGVAA
GSGITPILSIIATTLASEPHSRFTLLYGNRSSSGALFRDKLEDLKNRYLDRLNLIFVFSR
EQQDVDLYNGRIDADKCGQLFSRWLDVAGLDAAFICGPQAMTETVRDSLQANGMAKERIH
FELFAAAGSEARREAREAARQVDSALSHITVISDGRALSFDLPRNTQNVLDAGNAIGAEL
PYSCKAGVCSTCKCRVIEGEVEMDSNHALEDYEVAAGYVLSCQTYPVSDKVVLDFDQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory