Comparing PP_3282 FitnessBrowser__Putida:PP_3282 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
43% identity, 56% coverage: 9:289/505 of query aligns to 2:281/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
41% identity, 56% coverage: 9:289/505 of query aligns to 3:282/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
41% identity, 55% coverage: 9:287/505 of query aligns to 3:280/280 of 4kuhA
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
41% identity, 55% coverage: 9:287/505 of query aligns to 29:313/314 of P00348
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
41% identity, 55% coverage: 9:287/505 of query aligns to 29:313/314 of Q16836
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
40% identity, 55% coverage: 9:287/505 of query aligns to 6:290/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
40% identity, 55% coverage: 9:287/505 of query aligns to 6:290/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
40% identity, 55% coverage: 9:287/505 of query aligns to 6:290/293 of 1f12A
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
38% identity, 55% coverage: 10:289/505 of query aligns to 5:283/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
38% identity, 55% coverage: 10:289/505 of query aligns to 5:283/283 of 4pzdA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 55% coverage: 9:287/505 of query aligns to 7:286/286 of P9WNP7
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
37% identity, 56% coverage: 9:293/505 of query aligns to 363:645/763 of P40939
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
36% identity, 57% coverage: 9:298/505 of query aligns to 293:577/692 of 6iunB
Sites not aligning to the query:
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
33% identity, 59% coverage: 26:325/505 of query aligns to 333:620/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
33% identity, 59% coverage: 26:325/505 of query aligns to 333:620/715 of P28793
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
35% identity, 52% coverage: 26:289/505 of query aligns to 325:585/707 of 6yswA
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 53% coverage: 26:292/505 of query aligns to 333:597/707 of 1wdmA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
33% identity, 56% coverage: 9:290/505 of query aligns to 335:618/728 of 8oqlA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
33% identity, 56% coverage: 9:290/505 of query aligns to 338:621/731 of 4b3iA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
33% identity, 56% coverage: 9:290/505 of query aligns to 336:619/728 of 8oqrA
Sites not aligning to the query:
>PP_3282 FitnessBrowser__Putida:PP_3282
MAALASNVQVAVIGAGAMGAGIAQVAAQAGHPVKLYDNRPGAAAQAVTGIDRQLARLVDK
GKLLAAERETINARLCPVDTLEALADAGLVIEAIVENLQVKQALFSQLETLCAADCILAS
NTSSLSITSLAAGLERPQHVVGMHFFNPAPLMALVEVVSGLATDPAVAACIYATAQAWGK
QPVHARSTPGFIVNRVARPFYAESLRLLQEGAADCASLDALMRDSGGFRMGAFELTDLIG
HDVNYAVTCSVFDAFYGDFRFQPSLVQKELVDAGHLGRKTGQGFYRYAEGVERPQPAELH
SSACAEACVVEGNLGVMQPLVERLRQSGIAVTQRAGSGLIQVGDATLALSDGRLASQRAR
EDGLRNLVLLDLALDYSSATRIAISWSADTSDSARDQAVALLQRAGLKVTGVADLPGLVV
LRTVAMLANEAADAVLQGVGSAADIDLAMRAGVNYPCGPLAWAANIGIAHTLRVLDNLQC
SYGESRYRPSLLLRRCEAKGGTLHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory