SitesBLAST
Comparing PP_3349 FitnessBrowser__Putida:PP_3349 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
58% identity, 94% coverage: 12:400/413 of query aligns to 14:398/403 of P77589
- E27 (= E25) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D73) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ R274) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R278) mutation to D: Lack of 3HPP transport activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
37% identity, 93% coverage: 18:402/413 of query aligns to 27:441/452 of Q5EXK5
- D82 (= D73) mutation to A: Loss of activity.
- V311 (≠ R274) mutation to W: Loss of activity.
- D314 (= D277) mutation to A: Loss of activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
38% identity, 93% coverage: 17:399/413 of query aligns to 33:448/448 of Q51955
- D41 (≠ E25) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D28) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G69) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D73) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G76) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R108) mutation to A: Abolishes 4-HBA transport.
- E144 (= E128) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R166) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D277) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ G282) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R339) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R351) mutation to A: Abolishes 4-HBA transport.
- H444 (= H395) mutation to A: No change in 4-HBA transport and chemotaxis.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
28% identity, 88% coverage: 8:372/413 of query aligns to 37:407/444 of Q8NLB7
- D54 (≠ E25) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D28) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R74) mutation to A: Loss of transport activity.
- W309 (≠ R274) mutation to V: Loss of transport activity.
- D312 (= D277) mutation to A: Loss of transport activity.
- R313 (= R278) mutation to A: Loss of transport activity.
- I317 (≠ G282) mutation I->H,Y: Loss of transport activity.
- R386 (= R351) mutation to A: Loss of transport activity.
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
28% identity, 87% coverage: 10:370/413 of query aligns to 2:381/409 of 6e9nA
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
27% identity, 87% coverage: 10:370/413 of query aligns to 13:400/430 of P0AA76
- Y29 (≠ G26) binding
- D31 (= D28) mutation to N: Loss of galactonate transport activity.
- R32 (≠ L29) binding
- Y64 (≠ L61) binding
- E118 (≠ L115) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ G322) binding
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 49% coverage: 38:239/413 of query aligns to 96:303/495 of Q5Q0U0
- K136 (= K78) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R108) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ T111) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G112) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (≠ L115) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G116) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ L119) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P120) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I123) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ A126) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSL-KN 268:272 (≠ AQLFGP 208:213) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 334 P→R: Abolishes H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
28% identity, 46% coverage: 10:201/413 of query aligns to 5:195/393 of 6e9oA
Sites not aligning to the query:
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 35% coverage: 51:193/413 of query aligns to 191:346/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 73% coverage: 64:364/413 of query aligns to 191:514/616 of P36035
- K338 (≠ A199) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
29% identity, 35% coverage: 51:193/413 of query aligns to 191:346/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
33% identity, 20% coverage: 59:140/413 of query aligns to 213:294/742 of Q02563
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 mutation Missing: No change in uptake of BoNT/D or BoNT/E.
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 36% coverage: 70:217/413 of query aligns to 89:237/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 83% coverage: 20:362/413 of query aligns to 95:465/582 of Q9JI12
- H128 (≠ F54) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R108) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (≠ L115) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ P241) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
26% identity, 74% coverage: 55:361/413 of query aligns to 121:448/497 of 8bw7A
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
25% identity, 83% coverage: 20:362/413 of query aligns to 37:407/452 of 7t3nA
Sites not aligning to the query:
Q8VZR6 Inositol transporter 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 35% coverage: 70:212/413 of query aligns to 93:236/509 of Q8VZR6
Sites not aligning to the query:
- 479:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 481:482 ER→AA: No effect on targeting.
- 500:509 mutation Missing: Leads to endoplasmic reticulum relocalization.
- 502:504 mutation LLE->AAA,SSS: Leads to plasma membrane relocalization.
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
25% identity, 74% coverage: 55:361/413 of query aligns to 121:452/502 of 8bvsA
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
25% identity, 74% coverage: 55:361/413 of query aligns to 130:461/508 of 8bvtA
Sites not aligning to the query:
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 45% coverage: 58:244/413 of query aligns to 184:397/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
Query Sequence
>PP_3349 FitnessBrowser__Putida:PP_3349
MHHSCASSGKAVLTIGLCFLVALLEGLDLQATGIAAPHMAKAFNLTPAMLGWVFSAGLLG
LLPGALIGGWLADRFGRKAILIVAVLLFGGFSLGTAHAQTYDSLLIARLMTGLGLGAALP
ILIALASEAAPERLRSTAVSLTYCGVPLGGAVASLIGMAGVGDGWRTVFYVGGIAPIVIA
FVLMIWLKESQAFRAQGVAKAGSEGVLAQLFGPQQASRTLLLWVACFFTLTVLYMLLNWL
PSLLIGQGFSRPQAGAVQILFNLGGAAGSFLTGRMMDRGFAGRAVLIAYAGMLASLAGLG
LSSSFGLMLLAGFTAGYCAIGGQLVLYALAPTLYSTQVRATGLGASVAVGRLGSMAGPLA
AGQILAAGAGAGGLLMAAAPGLVLAALAARALLKHRTRTQRPEPGEAAAQDPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory