Comparing PP_3378 FitnessBrowser__Putida:PP_3378 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 97% coverage: 5:310/316 of query aligns to 3:307/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
30% identity, 97% coverage: 5:310/316 of query aligns to 2:306/311 of 2varA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
36% identity, 96% coverage: 5:308/316 of query aligns to 3:298/301 of 1v1aA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
36% identity, 96% coverage: 5:308/316 of query aligns to 3:298/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
36% identity, 96% coverage: 5:308/316 of query aligns to 3:298/300 of 1v1bA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
30% identity, 97% coverage: 6:310/316 of query aligns to 3:304/308 of 2dcnA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 90% coverage: 26:310/316 of query aligns to 18:304/306 of 5eynA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 87% coverage: 36:310/316 of query aligns to 31:306/319 of Q8ZKR2
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 90% coverage: 26:310/316 of query aligns to 22:308/310 of 5yggA
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
30% identity, 85% coverage: 40:308/316 of query aligns to 44:305/312 of 3in1A
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
34% identity, 94% coverage: 1:298/316 of query aligns to 15:303/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
35% identity, 88% coverage: 1:277/316 of query aligns to 15:278/294 of 4eumA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
30% identity, 87% coverage: 36:310/316 of query aligns to 27:295/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
30% identity, 87% coverage: 36:310/316 of query aligns to 27:295/299 of 1tz3A
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 98% coverage: 6:314/316 of query aligns to 4:308/308 of 3iq0B
7fcaD Pfkb(mycobacterium marinum) (see paper)
33% identity, 82% coverage: 15:273/316 of query aligns to 5:242/282 of 7fcaD
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
28% identity, 87% coverage: 36:310/316 of query aligns to 39:301/306 of 4xckA
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
30% identity, 83% coverage: 6:268/316 of query aligns to 2:252/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
30% identity, 83% coverage: 6:268/316 of query aligns to 3:253/304 of 3ih0A
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
28% identity, 87% coverage: 36:310/316 of query aligns to 39:301/305 of 1rk2A
Sites not aligning to the query:
>PP_3378 FitnessBrowser__Putida:PP_3378
MHEHDVLCFGETMAMFVAEQAGDLAGVGQFGKRIAGADSNVAIGLARLGFKVRWLSRVGD
DSLGRFVLDSLRCEGLDCSGVEVDANYPTGFQLKARSEDGSDPAVEYFRRGSAASRLSAA
MVSPVWLQARHVHATGIPLALSDSCRALSHALLDGMRAAGRSISFDPNLRPSLWPDQSSM
VREINALAAKADWVLPGLEEGRLLTGQHTPADIAAFYLDQGVELVVIKLGDAGAYFRSAK
GEGQVAPVPVSRVVDTVGAGDAFAVGVLSALLEGRPVAEAVARGNWCGSRAVQSRGDMEG
LPLRHELEAYDLRRSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory