SitesBLAST
Comparing PP_3382 FitnessBrowser__Putida:PP_3382 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
55% identity, 96% coverage: 18:417/417 of query aligns to 33:434/478 of Q47945
- Q37 (≠ V22) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
56% identity, 94% coverage: 25:417/417 of query aligns to 2:396/433 of 8gy2B
- binding heme c: C18 (= C41), C21 (= C44), H22 (= H45), T46 (= T69), I48 (= I71), Y59 (= Y81), L68 (≠ V90), R73 (≠ G95), V79 (≠ L101), Y80 (= Y102), M83 (= M105), F88 (≠ Y110), R126 (= R148), H165 (= H187), C166 (= C188), C169 (= C191), H170 (= H192), I201 (= I223), A202 (= A224), P203 (≠ K225), L205 (= L227), W216 (= W238), F224 (= F246), A234 (= A256), V235 (= V257), F236 (= F258), F236 (= F258), M239 (= M261), N301 (= N323), C302 (= C324), C305 (= C327), H306 (= H328), M316 (≠ V338), F317 (= F339), P318 (= P340), L320 (= L342), P324 (= P346), G342 (= G364), S352 (= S374), V354 (≠ F376), M356 (= M378), F359 (= F381), M375 (≠ I397)
- binding ubiquinone-10: C21 (= C44), L34 (= L57), P39 (= P62), P81 (= P103), L129 (= L151), W132 (= W154), E168 (≠ A190), R173 (= R195), I197 (≠ L219), D241 (= D263)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 93% coverage: 29:417/417 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C41), C16 (= C44), H17 (= H45), T42 (= T69), I44 (= I71), Y55 (= Y81), L75 (= L101), Y76 (= Y102), A78 (= A104), M79 (= M105), R122 (= R148), H161 (= H187), C162 (= C188), C165 (= C191), H166 (= H192), A191 (= A224), P192 (≠ K225), R223 (≠ A256), P227 (≠ G260), M228 (= M261), V289 (≠ N323), C290 (= C324), C293 (= C327), H294 (= H328), Y305 (≠ V338), Y306 (≠ F339), P307 (= P340), L309 (= L342), N312 (= N345), T313 (≠ P346), T314 (≠ V347), D322 (≠ S355), I327 (≠ V360), V331 (= V366), R333 (≠ A368), I340 (≠ F376), M342 (= M378), P343 (= P379), F345 (= F381)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 93% coverage: 29:417/417 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C41), C16 (= C44), H17 (= H45), T42 (= T69), I44 (= I71), F60 (= F86), L64 (≠ V90), L75 (= L101), Y76 (= Y102), M79 (= M105), P80 (= P106), Y84 (= Y110), R122 (= R148), C162 (= C188), C165 (= C191), H166 (= H192), I186 (≠ L219), W189 (= W222), A191 (= A224), P192 (≠ K225), I194 (≠ L227), W205 (= W238), Y213 (≠ F246), R223 (≠ A256), M228 (= M261), V303 (≠ N323), C304 (= C324), C307 (= C327), H308 (= H328), Y320 (≠ F339), P321 (= P340), L323 (= L342), T327 (≠ P346), T328 (≠ V347), D336 (≠ S355), I341 (≠ V360), V345 (= V366), R347 (≠ A368), I354 (≠ F376), M356 (= M378), F359 (= F381), I376 (≠ V393)
- binding ubiquinone-10: M36 (≠ I63), P77 (= P103), S124 (≠ P150), W128 (= W154), C165 (= C191), L173 (≠ S205)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 89% coverage: 29:400/417 of query aligns to 41:410/440 of 8gy3A
- binding heme c: Y52 (≠ D40), C53 (= C41), C56 (= C44), H57 (= H45), S84 (≠ T69), I86 (= I71), W97 (≠ Y81), F102 (= F86), L117 (= L101), F121 (≠ M105), F126 (≠ Y110), R163 (= R148), C203 (= C188), C206 (= C191), H207 (= H192), A232 (= A224), P233 (≠ K225), L235 (= L227), W245 (= W238), Y253 (≠ F246), L254 (= L247), G263 (≠ S255), S264 (≠ A256), M269 (= M261), Y292 (≠ L284), C337 (= C324), C340 (= C327), H341 (= H328), P353 (= P340), L355 (= L342), N358 (= N345), N359 (≠ P346), V372 (= V359), I377 (≠ G364), G382 (≠ A372), Q383 (≠ P373), I386 (≠ F376), M388 (= M378), F391 (= F381)
- binding ubiquinone-10: E55 (≠ A43), T76 (= T61), F78 (≠ I63), Y118 (= Y102), P119 (= P103), I160 (≠ L145), G166 (vs. gap), Q167 (≠ L151), F169 (≠ I153), W170 (= W154), H202 (= H187), R210 (= R195), L213 (≠ T198)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
32% identity, 24% coverage: 317:417/417 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C324), C33 (= C327), H34 (= H328), Y46 (≠ F339), P47 (= P340), T54 (≠ V347), V66 (= V359), I67 (≠ V360), R73 (≠ T369), I80 (≠ F376), M82 (= M378), P83 (= P379)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 28% coverage: 303:417/417 of query aligns to 339:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N323), C360 (= C324), C363 (= C327), H364 (= H328), P376 (= P340), P377 (≠ A341), L378 (= L342), F383 (≠ V347), N400 (vs. gap), G401 (= G364), Y410 (≠ S374), S412 (≠ F376), M414 (= M378), M417 (≠ F381)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 28% coverage: 303:417/417 of query aligns to 340:453/456 of 5oboA
- binding heme c: T360 (≠ N323), C361 (= C324), C364 (= C327), H365 (= H328), P377 (= P340), P378 (≠ A341), L379 (= L342), S382 (≠ N345), F384 (≠ V347), I395 (≠ V359), N401 (vs. gap), G402 (= G364), S413 (≠ F376), M415 (= M378), M418 (≠ F381)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
32% identity, 28% coverage: 303:417/417 of query aligns to 342:455/457 of 4ax3D
- binding heme c: C363 (= C324), C366 (= C327), H367 (= H328), P379 (= P340), P380 (≠ A341), L381 (= L342), S384 (≠ N345), F386 (≠ V347), N403 (vs. gap), G404 (= G364), S415 (≠ F376), M417 (= M378), M420 (≠ F381)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
30% identity, 26% coverage: 309:417/417 of query aligns to 332:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C324), C350 (= C327), H351 (= H328), F362 (= F339), P363 (= P340), P364 (≠ A341), L365 (= L342), S368 (≠ N345), Y370 (≠ V347), I382 (≠ V360), L386 (≠ G364), S387 (≠ T365), G388 (≠ V366), I390 (vs. gap), V392 (≠ T369), Y397 (≠ S374), N398 (= N375), G399 (≠ F376), V400 (≠ T377), M401 (= M378)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
35% identity, 24% coverage: 316:417/417 of query aligns to 2:110/129 of 1dt1A
- binding heme c: C9 (= C324), C12 (= C327), H13 (= H328), P25 (= P340), H30 (≠ N345), Y43 (≠ S355), V47 (= V359), Q53 (vs. gap), G54 (= G364), G65 (≠ F376), M67 (= M378), F70 (= F381)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
35% identity, 24% coverage: 316:417/417 of query aligns to 3:111/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C327), H14 (= H328), P26 (= P340), L28 (= L342), H31 (≠ N345), Y44 (≠ S355), V48 (= V359), Q54 (vs. gap), G55 (= G364), G66 (≠ F376), M68 (= M378)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
35% identity, 24% coverage: 316:417/417 of query aligns to 3:111/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y320), C10 (= C324), C13 (= C327), H14 (= H328), P26 (= P340), H31 (≠ N345), Y44 (≠ S355), Q54 (vs. gap), G55 (= G364), G66 (≠ F376), M68 (= M378), F71 (= F381)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
35% identity, 24% coverage: 316:417/417 of query aligns to 4:112/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C324), C14 (= C327), H15 (= H328), F26 (= F339), P27 (= P340), L29 (= L342), H32 (≠ N345), Y45 (≠ S355), L54 (vs. gap), Q55 (vs. gap), G56 (= G364), G67 (≠ F376), M69 (= M378), F72 (= F381)
Sites not aligning to the query:
Query Sequence
>PP_3382 FitnessBrowser__Putida:PP_3382
MSMKTLLIATLVLGAGAAAQAVANDDAQVRLGEYLARAGDCVACHTAKGGKPFAGGLPME
TPIGTVYSTNITPAASGIGQYSFEDFDQAVRRGIGKDGSTLYPAMPYPSYARVSEQDMQA
LYAYFMKGVAPVEQANKASDIPWPLSMRWPLAIWRGVFAPEAKPWQASATADPVVNRGAY
LVEGLGHCGACHTPRALTMQEKALSAADGEQFLAGSAPLEGWIAKNLRGDHKDGLGSWSE
AQLVQFLKTGRSDRSAVFGGMSDVVEHSMQHMSDADLTAIARYLKTLPPSNPDDQLHVYD
KQVADALWKGDDSKPGAAVYIDNCAACHRTDGQGYTRVFPALAGNPVVQTADATSLIHVV
LAGGTVPATHSAPSNFTMPAFGWRLSDQEVAEVVNFIRSSWGNQGSAVTAGDVKSLR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory