SitesBLAST
Comparing PP_3391 FitnessBrowser__Putida:PP_3391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
23% identity, 84% coverage: 36:402/438 of query aligns to 23:393/430 of P0AA76
- Y29 (= Y42) binding
- D31 (= D44) mutation to N: Loss of galactonate transport activity.
- R32 (= R45) binding
- Y64 (= Y77) binding
- E118 (= E131) mutation to Q: Loss of galactonate transport activity.
- W358 (= W367) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
24% identity, 84% coverage: 35:402/438 of query aligns to 15:374/409 of 6e9nA
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 73% coverage: 15:334/438 of query aligns to 77:396/534 of P53322
- K283 (≠ R223) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 84% coverage: 35:402/438 of query aligns to 18:358/393 of 6e9oA
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 57% coverage: 39:287/438 of query aligns to 52:285/444 of Q8NLB7
- D54 (≠ S41) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D44) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R90) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
25% identity, 80% coverage: 89:438/438 of query aligns to 82:439/452 of Q5EXK5
- D82 (≠ K89) mutation to A: Loss of activity.
- V311 (≠ R312) mutation to W: Loss of activity.
- D314 (= D315) mutation to A: Loss of activity.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 47% coverage: 33:238/438 of query aligns to 117:314/605 of Q9GQQ0
- E217 (= E131) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
20% identity, 47% coverage: 57:260/438 of query aligns to 130:324/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 78% coverage: 89:429/438 of query aligns to 75:387/403 of P77589
- D75 (≠ K89) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ R312) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R316) mutation to D: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
21% identity, 86% coverage: 48:424/438 of query aligns to 90:468/495 of Q9NRA2
- K136 (≠ R99) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L139) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ MN 154:155) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ LA 229:230) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ENLAQ 231:235) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G293) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P299) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (≠ A331) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Query Sequence
>PP_3391 FitnessBrowser__Putida:PP_3391
MVALTGELARERNDSHINELLLYRRVAWRIMPLAIICFLFSYFDRINISFAKTQMQQELG
LSDAAYGLAASMFFVGYVLFEVPSSLGLKRYGAPAWICRIMVSWGLATAALVFAYTQYTL
YFLRFLIGVMEAGFGPAILFYLACWFPRKHLAKMNGLWFLAVPLAGAVGGPAAGFLLGTM
DGVLGLAGWHWLFLMSGLPCVLLGLLVLWKLDRDIEAAKWLSREEKDLLAENLAQDKRTA
KPILGSIWRVLLTREVAIMAFIYYVVKTASYGLNFWMPHLIKSSGVQDMLWVGVLSALPY
AVACIGMVLLTRHSDRTGERKRYLVYCLLAAAVGYLLACLFSDSPFAMMTALVLATAGTF
IAIPIFWTIPQSTFSGLAIATGTAAINSVGQLSGIVAPVMVGKINDLTDSTYMGMLSIAP
LILVACLVVMRYVRNPKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory