Comparing PP_3433 FitnessBrowser__Putida:PP_3433 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
89% identity, 98% coverage: 5:356/358 of query aligns to 1:352/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
87% identity, 97% coverage: 2:349/358 of query aligns to 1:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
86% identity, 98% coverage: 3:353/358 of query aligns to 1:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
82% identity, 96% coverage: 3:344/358 of query aligns to 1:320/320 of 7xntC
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
32% identity, 94% coverage: 13:347/358 of query aligns to 295:624/635 of Q88JU3
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
36% identity, 78% coverage: 72:349/358 of query aligns to 79:360/362 of 1t47A
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
33% identity, 94% coverage: 13:347/358 of query aligns to 297:621/624 of 5hmqD
Sites not aligning to the query:
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
30% identity, 88% coverage: 31:346/358 of query aligns to 29:343/357 of O52791
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
30% identity, 86% coverage: 48:356/358 of query aligns to 60:382/393 of Q02110
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 88% coverage: 31:346/358 of query aligns to 28:341/346 of 2r5vA
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 86% coverage: 48:356/358 of query aligns to 60:382/393 of P32755
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
28% identity, 79% coverage: 68:349/358 of query aligns to 64:334/335 of 7yvvA
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
27% identity, 87% coverage: 48:357/358 of query aligns to 52:375/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
28% identity, 85% coverage: 48:353/358 of query aligns to 54:373/374 of 8im2A
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
27% identity, 88% coverage: 34:349/358 of query aligns to 27:342/343 of 3zgjB
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
27% identity, 84% coverage: 48:349/358 of query aligns to 54:369/371 of 8im3A
7x8iA Crystal structure of athppd-shikonin complex (see paper)
29% identity, 79% coverage: 65:346/358 of query aligns to 93:376/380 of 7x8iA
7x64A Crystal structure of athppd-y18027 complex (see paper)
29% identity, 79% coverage: 65:346/358 of query aligns to 93:376/380 of 7x64A
7x5sA Crystal structure of athppd-y14157 complex
29% identity, 79% coverage: 65:346/358 of query aligns to 93:376/380 of 7x5sA
7ezqA Complex structure of athppd with inhibitor y15832
29% identity, 79% coverage: 65:346/358 of query aligns to 93:376/382 of 7ezqA
>PP_3433 FitnessBrowser__Putida:PP_3433
MADIFENPMGLMGFEFIELASPTPGVLEPVFQILGFTKVATHRSKDVHLYRQGGINLILN
NEPKSIASYFAAEHGPSVCGMAFRVRNAHEAYARALELGAQPVEIETGPMELRLPAIKGI
GGAPLYLIDRFEEGSSIYDIDFNFIEGVDRNPVGAGLKIIDHLTHNVYRGRMAYWAGFYE
KLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQ
HVAFLTDDLLKTWDALKGLGMRFMTAPPQTYYEMLEERLPGHGEPVDQLQARGILLDGAS
QPGDKRLLLQIFSETLLGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLSTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory