SitesBLAST
Comparing PP_3446 FitnessBrowser__Putida:PP_3446 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
55% identity, 95% coverage: 29:529/530 of query aligns to 14:512/514 of P04968
- K62 (= K77) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N104) binding
- GGGGL 188:192 (= GGGGL 204:208) binding
- S315 (= S331) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
54% identity, 95% coverage: 29:529/530 of query aligns to 10:492/494 of 1tdjA
- active site: K58 (= K77), A83 (= A102), E209 (= E229), S213 (= S233), C215 (= C235), G237 (= G257), L310 (≠ D330), S311 (= S331)
- binding pyridoxal-5'-phosphate: F57 (= F76), K58 (= K77), N85 (= N104), G184 (= G204), G185 (= G205), G186 (= G206), G187 (= G207), G237 (= G257), E282 (= E302), S311 (= S331), G312 (= G332)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
40% identity, 56% coverage: 43:339/530 of query aligns to 19:312/319 of A4F2N8
- K53 (= K77) mutation to A: Loss of enzymatic activity.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
38% identity, 59% coverage: 31:344/530 of query aligns to 14:322/326 of 2gn2A
- active site: K56 (= K77), A81 (= A102), Q207 (≠ E229), V211 (≠ S233), G213 (≠ C235), G235 (= G257), I308 (≠ D330), S309 (= S331)
- binding cytidine-5'-monophosphate: R51 (≠ P72), T52 (= T73), G53 (≠ F74), A114 (≠ G135), D117 (≠ S138), Y118 (≠ R139), N312 (= N334)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 58% coverage: 36:342/530 of query aligns to 5:319/323 of O59791
- S82 (≠ A102) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
35% identity, 58% coverage: 36:342/530 of query aligns to 1:315/319 of 2zr8A
- active site: K53 (= K77), S78 (≠ A102), E204 (= E229), G208 (≠ S233), D210 (≠ C235), G232 (= G257), I303 (≠ D330), S304 (= S331)
- binding magnesium ion: E204 (= E229), G208 (≠ S233), D210 (≠ C235)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F76), K53 (= K77), S77 (= S101), S78 (≠ A102), N80 (= N104), H81 (= H105), P147 (= P171), G179 (= G204), G180 (= G205), G181 (= G206), G182 (= G207), G232 (= G257), E277 (= E302), T279 (≠ S304), S304 (= S331)
- binding serine: S78 (≠ A102), R129 (≠ A153), D231 (= D256), G232 (= G257), A233 (≠ V258), Q234 (≠ A259), T235 (≠ V260)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
35% identity, 58% coverage: 36:342/530 of query aligns to 1:315/319 of 2zpuA
- active site: K53 (= K77), S78 (≠ A102), E204 (= E229), G208 (≠ S233), D210 (≠ C235), G232 (= G257), I303 (≠ D330), S304 (= S331)
- binding magnesium ion: E204 (= E229), G208 (≠ S233), D210 (≠ C235)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F76), K53 (= K77), S77 (= S101), S78 (≠ A102), N80 (= N104), H81 (= H105), P147 (= P171), G179 (= G204), G180 (= G205), G181 (= G206), G182 (= G207), G232 (= G257), E277 (= E302), T279 (≠ S304), S304 (= S331)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
35% identity, 57% coverage: 40:342/530 of query aligns to 15:314/318 of 1wtcA
- active site: K52 (= K77), S77 (≠ A102), E203 (= E229), G207 (≠ S233), D209 (≠ C235), G231 (= G257), I302 (≠ D330), S303 (= S331)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ I45), K47 (≠ P72), M48 (≠ T73), A109 (≠ E134), A110 (≠ G135), Y114 (≠ R139)
- binding magnesium ion: E203 (= E229), G207 (≠ S233), D209 (≠ C235)
- binding pyridoxal-5'-phosphate: F51 (= F76), K52 (= K77), N79 (= N104), G178 (= G204), G179 (= G205), G180 (= G206), G181 (= G207), G231 (= G257), E276 (= E302), T278 (≠ S304), S303 (= S331)
1v71A Crystal structure of s.Pombe serine racemase
35% identity, 57% coverage: 40:342/530 of query aligns to 15:314/318 of 1v71A
- active site: K52 (= K77), S77 (≠ A102), E203 (= E229), G207 (≠ S233), D209 (≠ C235), G231 (= G257), I302 (≠ D330), S303 (= S331)
- binding magnesium ion: E203 (= E229), G207 (≠ S233), D209 (≠ C235)
- binding pyridoxal-5'-phosphate: F51 (= F76), K52 (= K77), N79 (= N104), G178 (= G204), G179 (= G205), G180 (= G206), G181 (= G207), G231 (= G257), E276 (= E302), T278 (≠ S304), S303 (= S331), G304 (= G332)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
36% identity, 50% coverage: 46:310/530 of query aligns to 37:299/339 of Q7XSN8
- E219 (= E229) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ C235) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 24:312/322 of 3l6bA
- active site: K54 (= K77), S77 (≠ A102), E203 (= E229), A207 (≠ S233), D209 (≠ N234), G232 (= G257), T278 (≠ S304), L305 (≠ D330), S306 (= S331)
- binding malonate ion: K54 (= K77), S76 (= S101), S77 (≠ A102), N79 (= N104), H80 (= H105), R128 (≠ A153), G232 (= G257)
- binding manganese (ii) ion: E203 (= E229), A207 (≠ S233), D209 (≠ N234)
- binding pyridoxal-5'-phosphate: F53 (= F76), K54 (= K77), N79 (= N104), G178 (= G204), G179 (= G205), G180 (= G206), G181 (= G207), M182 (≠ L208), V233 (= V258), E276 (= E302), T278 (≠ S304), S306 (= S331), G307 (= G332)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:336/530 of query aligns to 23:310/310 of 7nbgDDD
- active site: K53 (= K77), S76 (≠ A102), E202 (= E229), A206 (≠ S233), D208 (≠ N234), G231 (= G257), L304 (≠ D330), S305 (= S331)
- binding calcium ion: E202 (= E229), A206 (≠ S233), D208 (≠ N234)
- binding magnesium ion: N239 (≠ H266)
- binding ortho-xylene: S76 (≠ A102), Q81 (= Q107), I96 (= I122), Y113 (≠ R139)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N78 (= N104), G177 (= G204), G178 (= G205), G179 (= G206), G180 (= G207), M181 (≠ L208), G231 (= G257), V232 (= V258), E275 (= E302), T277 (≠ S304), S305 (= S331), G306 (= G332)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 57% coverage: 47:348/530 of query aligns to 23:320/320 of 6zspAAA
- active site: K53 (= K77), S74 (≠ A102), E200 (= E229), A204 (≠ S233), D206 (≠ N234), G229 (= G257), L302 (≠ D330), S303 (= S331)
- binding adenosine-5'-triphosphate: S28 (≠ A52), S29 (≠ P53), I30 (≠ A54), K48 (≠ P72), T49 (= T73), Q79 (= Q107), Y111 (≠ R139), E266 (≠ D295), R267 (≠ D296), K269 (≠ R298), N306 (= N334)
- binding magnesium ion: E200 (= E229), A204 (≠ S233), D206 (≠ N234)
- binding malonate ion: K53 (= K77), S73 (= S101), S74 (≠ A102), N76 (= N104), H77 (= H105), R125 (≠ A153), G229 (= G257), S232 (≠ A261)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/323 of 7nbfAAA
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding magnesium ion: N244 (≠ H266)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N83 (= N104), G182 (= G204), G183 (= G205), G184 (= G206), G185 (= G207), M186 (≠ L208), G236 (= G257), V237 (= V258), T282 (≠ S304), S310 (= S331), G311 (= G332)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T47), P24 (= P48), L26 (≠ Q50), T27 (≠ A51), F46 (≠ L70)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/323 of 7nbdAAA
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y294), L278 (≠ I300), V314 (= V335), L316 (≠ F337)
- binding magnesium ion: N244 (≠ H266)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N83 (= N104), G182 (= G204), G183 (= G205), G184 (= G206), G185 (= G207), M186 (≠ L208), G236 (= G257), V237 (= V258), E280 (= E302), T282 (≠ S304), S310 (= S331), G311 (= G332)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/323 of 7nbcCCC
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding biphenyl-4-ylacetic acid: T78 (= T99), H79 (≠ A100), H84 (= H105), V148 (= V169), H149 (≠ P170), P150 (= P171)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N83 (= N104), G182 (= G204), G183 (= G205), G184 (= G206), G185 (= G207), M186 (≠ L208), G236 (= G257), V237 (= V258), T282 (≠ S304), S310 (= S331), G311 (= G332)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/323 of 7nbcAAA
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding magnesium ion: N244 (≠ H266)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N83 (= N104), G182 (= G204), G183 (= G205), G184 (= G206), G185 (= G207), M186 (≠ L208), G236 (= G257), V237 (= V258), T282 (≠ S304), S310 (= S331), G311 (= G332)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/322 of 7nbgAAA
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding pyridoxal-5'-phosphate: F52 (= F76), K53 (= K77), N83 (= N104), G182 (= G204), G183 (= G205), G184 (= G206), G185 (= G207), M186 (≠ L208), G236 (= G257), V237 (= V258), T282 (≠ S304), S310 (= S331), G311 (= G332)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A102), G85 (≠ A106), Q86 (= Q107), I101 (= I122), K111 (= K132), I115 (≠ V136), Y118 (≠ R139)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
34% identity, 55% coverage: 47:337/530 of query aligns to 23:316/320 of 7nbhAAA
- active site: K53 (= K77), S81 (≠ A102), E207 (= E229), A211 (≠ S233), D213 (≠ N234), G236 (= G257), L309 (≠ D330), S310 (= S331)
- binding calcium ion: E207 (= E229), A211 (≠ S233), D213 (≠ N234)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A102), G85 (≠ A106), Q86 (= Q107), K111 (= K132), I115 (≠ V136), Y118 (≠ R139), D235 (= D256), P281 (= P303), N313 (= N334), V314 (= V335), D315 (≠ N336)
5cvcA Structure of maize serine racemase (see paper)
36% identity, 50% coverage: 47:310/530 of query aligns to 22:283/329 of 5cvcA
- active site: K52 (= K77), S77 (≠ A102), E203 (= E229), A207 (≠ S233), D209 (≠ C235), G231 (= G257)
- binding magnesium ion: E203 (= E229), A207 (≠ S233), D209 (≠ C235)
- binding pyridoxal-5'-phosphate: F51 (= F76), K52 (= K77), N79 (= N104), S178 (≠ G204), G179 (= G205), G180 (= G206), G181 (= G207), L232 (≠ V258), E275 (= E302)
Sites not aligning to the query:
Query Sequence
>PP_3446 FitnessBrowser__Putida:PP_3446
MGNVKIAKESSMTSFSVPRTTVTPQQLLSEQVRRILAAPVYDLAIETPLQAAPALSAALG
NQVLLKREDLQPTFSFKIRGAYTRLSRLTDVQRERGVITASAGNHAQGVALAASHLGMKA
TIVMPTTTPSLKVEGVRSRGGHVVLHGESFPHALTHALKLADSEGATFVPPFDDPDVIAG
QGTVAMEILRQRPGALDAIFVPVGGGGLIAGIAAYVKYLRPDVKVIGVEPADSNCLQAAM
AVGERVILPQVGTFADGVAVAQIGAHCFELCRHFVDEVVTVSSDELCAAIKDIYDDTRSI
TEPSGALAVAGIKKYVAREGVQGQTLVAIDSGANVNFDRLRHVAERAELGEQREAIIAVT
IPEQPGSFRAFCHALGKRQITEFNYRFYPGKEARLFVGVQTHPVHDPREQLLASLREQGY
SVLDLTDNELAKLHVRHTVGGHAASGADERVLRFEFPERPGALLGFLERLGKRWNISLFH
YRNHGAAEARVFAALEVPADELAGLPSTLDEMGYRYWDETDNPAYKLFLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory