SitesBLAST
Comparing PP_3511 FitnessBrowser__Putida:PP_3511 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jifB Crystal structures of branched-chain aminotransferase from pseudomonas sp. Uw4 (see paper)
84% identity, 98% coverage: 6:338/339 of query aligns to 1:334/334 of 6jifB
- binding pyridoxal-5'-phosphate: R77 (= R82), R169 (= R173), K179 (= K183), Y184 (= Y188), E215 (= E219), S218 (= S222), A219 (= A223), N220 (= N224), L239 (= L243), G241 (= G245), I242 (= I246), T243 (= T247), G279 (= G283), T280 (= T284)
3uyyB Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
70% identity, 98% coverage: 6:338/339 of query aligns to 3:337/337 of 3uyyB
- active site: K181 (= K183)
- binding pyridoxal-5'-phosphate: R79 (= R82), R171 (= R173), K181 (= K183), Y186 (= Y188), E217 (= E219), G219 (= G221), A220 (≠ S222), A221 (= A223), S244 (≠ G245), I245 (= I246), T246 (= T247), G282 (= G283), T283 (= T284)
3uzoA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
70% identity, 98% coverage: 6:338/339 of query aligns to 1:335/335 of 3uzoA
- active site: K179 (= K183)
- binding glutamic acid: Y48 (= Y53), F53 (= F58), R122 (= R126), V134 (= V138), Y152 (= Y156), T281 (= T284), A282 (= A285)
- binding pyridoxal-5'-phosphate: R77 (= R82), K179 (= K183), Y184 (= Y188), E215 (= E219), G217 (= G221), A218 (≠ S222), A219 (= A223), N220 (= N224), L240 (= L243), S242 (≠ G245), I243 (= I246), T244 (= T247), G280 (= G283), T281 (= T284)
3uzbA Crystal structures of branched-chain aminotransferase from deinococcus radiodurans complexes with alpha-ketoisocaproate and l-glutamate suggest its radio-resistance for catalysis (see paper)
70% identity, 98% coverage: 6:338/339 of query aligns to 1:335/335 of 3uzbA
- active site: K179 (= K183)
- binding 2-oxo-4-methylpentanoic acid: Y120 (= Y124), K179 (= K183), T281 (= T284), A282 (= A285)
- binding pyridoxal-5'-phosphate: R77 (= R82), K179 (= K183), Y184 (= Y188), E215 (= E219), G217 (= G221), A218 (≠ S222), A219 (= A223), N220 (= N224), S242 (≠ G245), I243 (= I246), T244 (= T247), G280 (= G283), T281 (= T284)
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
42% identity, 91% coverage: 31:338/339 of query aligns to 45:362/363 of 3dtgA
- active site: K199 (= K183)
- binding O-benzylhydroxylamine: F72 (= F58), Y171 (= Y156), Y204 (= Y188)
- binding pyridoxal-5'-phosphate: R96 (= R82), R189 (= R173), K199 (= K183), Y204 (= Y188), E235 (= E219), G238 (≠ S222), L263 (= L243), I266 (= I246), T267 (= T247), T309 (= T284)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
42% identity, 91% coverage: 31:338/339 of query aligns to 45:362/363 of 3dtfA
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
42% identity, 91% coverage: 31:338/339 of query aligns to 50:367/368 of A0R066
- R101 (= R82) binding
- Y209 (= Y188) binding
- K299 (≠ R275) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T284) binding
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
41% identity, 91% coverage: 31:338/339 of query aligns to 17:334/335 of 3ht5A
- active site: K171 (= K183)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R82), K171 (= K183), Y176 (= Y188), E207 (= E219), G210 (≠ S222), M211 (≠ A223), N212 (= N224), L235 (= L243), G237 (= G245), I238 (= I246), T239 (= T247), T281 (= T284)
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
39% identity, 91% coverage: 31:338/339 of query aligns to 16:325/326 of 5u3fA
- active site: K162 (= K183)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G60), R67 (= R82), Y110 (= Y124), K162 (= K183), Y167 (= Y188), E198 (= E219), G201 (≠ S222), M202 (≠ A223), N203 (= N224), L226 (= L243), G228 (= G245), I229 (= I246), T230 (= T247), T272 (= T284)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 24:357/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R173), K201 (= K183), Y206 (= Y188), E236 (= E219), T239 (≠ S222), M240 (≠ A223), L265 (= L243), G267 (= G245), V268 (≠ I246), T269 (= T247), G311 (= G283), T312 (= T284)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y124), G153 (= G137), V154 (= V138), Y172 (= Y156), Q213 (≠ G195), Q223 (≠ D205), T239 (≠ S222), A313 (= A285)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 24:357/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R82), K201 (= K183), Y206 (= Y188), E236 (= E219), T239 (≠ S222), M240 (≠ A223), L265 (= L243), G267 (= G245), V268 (≠ I246), T269 (= T247), G311 (= G283), T312 (= T284)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y124), G153 (= G137), V154 (= V138), Y172 (= Y156), Q213 (≠ G195), Q223 (≠ D205), T239 (≠ S222), A313 (= A285)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 24:357/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R173), K201 (= K183), Y206 (= Y188), E236 (= E219), T239 (≠ S222), M240 (≠ A223), N241 (= N224), L265 (= L243), G267 (= G245), V268 (≠ I246), T269 (= T247), G311 (= G283), T312 (= T284)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F13), Y172 (= Y156), Q223 (≠ D205), T239 (≠ S222), A313 (= A285)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 24:357/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R82), R191 (= R173), K201 (= K183), Y206 (= Y188), E236 (= E219), T239 (≠ S222), M240 (≠ A223), L265 (= L243), G267 (= G245), V268 (≠ I246), T269 (= T247), G311 (= G283), T312 (= T284)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), Y140 (= Y124), G153 (= G137), V154 (= V138), Y172 (= Y156), Q213 (≠ G195), Q223 (≠ D205), A313 (= A285)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 24:357/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R82), K201 (= K183), Y206 (= Y188), E236 (= E219), T239 (≠ S222), N241 (= N224), L265 (= L243), G267 (= G245), V268 (≠ I246), T269 (= T247), T312 (= T284)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R126), G153 (= G137), V154 (= V138), Y172 (= Y156), F173 (= F157), V181 (≠ H164), Q223 (≠ D205), V237 (= V220), T239 (≠ S222), M240 (≠ A223), G311 (= G283), A313 (= A285), C317 (≠ T289)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 23:356/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R82), R190 (= R173), K200 (= K183), Y205 (= Y188), E235 (= E219), T238 (≠ S222), M239 (≠ A223), L264 (= L243), G266 (= G245), V267 (≠ I246), T268 (= T247), G310 (= G283), T311 (= T284)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F13), Y68 (= Y53), F73 (= F58), Y139 (= Y124), G152 (= G137), V153 (= V138), Y171 (= Y156), Q212 (≠ G195), Q222 (≠ D205), T238 (≠ S222), A312 (= A285)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 23:356/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R82), R190 (= R173), K200 (= K183), Y205 (= Y188), E235 (= E219), T238 (≠ S222), M239 (≠ A223), N240 (= N224), L264 (= L243), G266 (= G245), V267 (≠ I246), T268 (= T247), T311 (= T284)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F13), Y139 (= Y124), G152 (= G137), V153 (= V138), Y171 (= Y156), Q212 (≠ G195), Q221 (≠ A204), Q222 (≠ D205), V223 (≠ A206), T238 (≠ S222)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
33% identity, 95% coverage: 9:329/339 of query aligns to 23:356/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R82), K200 (= K183), Y205 (= Y188), E235 (= E219), T238 (≠ S222), M239 (≠ A223), L264 (= L243), G266 (= G245), V267 (≠ I246), T268 (= T247), T311 (= T284)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F13), Y139 (= Y124), G152 (= G137), V153 (= V138), Y171 (= Y156), Q212 (≠ G195), Q222 (≠ D205), A312 (= A285)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
32% identity, 95% coverage: 9:330/339 of query aligns to 25:359/366 of 2abjA
- active site: K202 (= K183)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F13), F75 (= F58), Y141 (= Y124), Y173 (= Y156), K202 (= K183), Q224 (≠ D205), T240 (≠ S222), M241 (≠ A223), G312 (= G283), A314 (= A285), C315 (≠ A286)
- binding pyridoxal-5'-phosphate: R99 (= R82), R192 (= R173), K202 (= K183), Y207 (= Y188), E237 (= E219), T240 (≠ S222), M241 (≠ A223), N242 (= N224), L266 (= L243), G268 (= G245), V269 (≠ I246), T270 (= T247), T313 (= T284)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
32% identity, 95% coverage: 9:329/339 of query aligns to 24:354/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R82), R188 (= R173), K198 (= K183), Y203 (= Y188), E233 (= E219), T236 (≠ S222), M237 (≠ A223), N238 (= N224), L262 (= L243), G264 (= G245), V265 (≠ I246), T266 (= T247), T309 (= T284)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F13), Y69 (= Y53), F74 (= F58), G153 (= G137), V154 (= V138), Y172 (= Y156), Q210 (≠ G195), Q219 (≠ A204), Q220 (≠ D205), T236 (≠ S222)
7ntrA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and substrate mimic 3-phenylpropionate (see paper)
32% identity, 95% coverage: 9:329/339 of query aligns to 24:354/362 of 7ntrA
- binding hydrocinnamic acid: F28 (= F13), Y69 (= Y53), V154 (= V138), T236 (≠ S222), G308 (= G283), T309 (= T284), A310 (= A285)
- binding pyridoxal-5'-phosphate: R98 (= R82), R188 (= R173), K198 (= K183), Y203 (= Y188), E233 (= E219), T236 (≠ S222), M237 (≠ A223), L262 (= L243), G264 (= G245), V265 (≠ I246), T266 (= T247), G308 (= G283), T309 (= T284)
Query Sequence
>PP_3511 FitnessBrowser__Putida:PP_3511
MSNESINWDKLGFDYIKTDKRYLSVWRNGEWDKGTLTEDNVLHISEGSTALHYGQQCFEG
LKAYRCKDGSINLFRPDQNAARMQRSCARLLMPHVPTDVFIEACKQVVKANEKFVPPHGK
GALYLRPFVIGTGDNIGVRTAPEFIFSVFAIPVGSYFKGGMKPHNFQISSFDRAAPQGTG
AAKVGGNYAASLQPGAEAKKANFADAIYLDPLTHTKIEEVGSANFFGITANNEFVTPKSA
SVLPGITRLSLMELAQSRLGMTVIEGDVEISKLDRFVEAGACGTAAVITPIGGIEYNGKL
HVFHDLEKVGPVTQKLYNELTGIQSGDVEAPAGWIVKVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory