Comparing PP_3559 FitnessBrowser__Putida:PP_3559 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
38% identity, 44% coverage: 130:252/282 of query aligns to 54:176/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
30% identity, 67% coverage: 93:281/282 of query aligns to 55:243/553 of B5Z7I3
Sites not aligning to the query:
8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
24% identity, 54% coverage: 122:273/282 of query aligns to 98:253/265 of 8wm8B
>PP_3559 FitnessBrowser__Putida:PP_3559
MSSGFPQTLQFSFADSINRLVDWLVLNYGDHLRSLSDQLLQLLVGLENLLRLLPWWLLLL
LVGLLAWHASRSLLRSAVLVALLALIGMLGLWDKLLQTLALVLVSTGLCVLVGVPLGILL
AARPLARRLLLPVLDVMQTLPAFVYLIPVLMLFGLGKVPAVFATLIYALPPLVRLTELGL
SQIDPSLLQAAHGLGASRWQRLRRIALPLALPSIMAGLNQSVMMALSMVVVASMIGARGL
GEDVLAGIQTLNVGQGMEAGLAIVALAMVIDRISQAYGRSSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory