SitesBLAST
Comparing PP_3596 FitnessBrowser__Putida:PP_3596 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 100% coverage: 2:413/414 of query aligns to 24:383/383 of 5i39A
- active site: F66 (≠ Q61), Q69 (≠ A64), A70 (≠ L65), Q248 (≠ D281), P267 (= P300)
- binding flavin-adenine dinucleotide: V30 (≠ L8), G31 (= G9), G33 (= G11), I34 (= I12), L35 (≠ V13), V53 (≠ I31), E54 (≠ D32), K55 (≠ R33), Q62 (≠ R50), S63 (= S51), F66 (≠ Q61), Y67 (≠ L62), Q69 (≠ A64), A196 (vs. gap), A197 (= A222), G226 (≠ L250), G227 (= G251), W229 (≠ Q253), Q248 (≠ D281), Q250 (≠ A283), G321 (= G350), M323 (≠ R352), T348 (≠ H377), G349 (≠ A378), W350 (≠ H379), G351 (= G381), M352 (≠ L382), T353 (= T383)
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
28% identity, 48% coverage: 215:411/414 of query aligns to 167:366/370 of 6pxsA
- binding flavin-adenine dinucleotide: Y174 (≠ A222), A203 (≠ L250), W206 (≠ Q253), I210 (≠ L257), Y250 (≠ V297), G305 (= G350), R307 (= R352), G333 (≠ A378), A334 (≠ H379), S335 (≠ H380), G336 (= G381), L337 (= L382), T338 (= T383)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 30, 32, 33, 36, 37, 38, 40, 41, 42, 43, 44
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
25% identity, 55% coverage: 176:404/414 of query aligns to 105:354/369 of S5FMM4
- S202 (≠ L250) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L382) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L392) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
37% identity, 19% coverage: 336:413/414 of query aligns to 357:433/433 of 5hxwA
- binding cetyl-trimethyl-ammonium: M373 (≠ R352), E379 (≠ M358), G399 (≠ A378), W400 (≠ H379)
- binding flavin-adenine dinucleotide: G371 (= G350), M373 (≠ R352), T398 (≠ H377), G399 (≠ A378), W400 (≠ H379), G401 (= G381), M402 (≠ L382), T403 (= T383)
Sites not aligning to the query:
- active site: 58, 61, 62, 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320
- binding flavin-adenine dinucleotide: 22, 23, 25, 26, 27, 46, 47, 53, 54, 55, 57, 58, 59, 60, 61, 188, 189, 218, 219, 221, 240, 242, 331
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 41% coverage: 234:404/414 of query aligns to 186:354/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ L250), G203 (= G251), W205 (≠ Q253), F209 (≠ L257), G300 (= G350), R302 (= R352), H327 (= H377), F328 (≠ A378), R329 (≠ H379), N330 (≠ H380), G331 (= G381), I332 (≠ L382)
- binding glycolic acid: Y246 (≠ V297), R302 (= R352), R329 (≠ H379)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
27% identity, 41% coverage: 234:404/414 of query aligns to 186:354/369 of O31616
- H244 (≠ I289) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R352) binding
- 327:333 (vs. 377:383, 29% identical) binding
- R329 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
23% identity, 100% coverage: 2:413/414 of query aligns to 25:400/824 of Q8GAI3
- W66 (= W89) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ S97) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
26% identity, 41% coverage: 234:404/414 of query aligns to 186:354/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V297), R302 (= R352), R329 (≠ H379)
- binding flavin-adenine dinucleotide: S202 (≠ L250), G203 (= G251), W205 (≠ Q253), F209 (≠ L257), G300 (= G350), R302 (= R352), H327 (= H377), R329 (≠ H379), N330 (≠ H380), G331 (= G381), I332 (≠ L382)
- binding phosphate ion: R254 (= R306)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
26% identity, 47% coverage: 217:412/414 of query aligns to 175:369/377 of Q5L2C2
- V180 (≠ A222) binding
- R309 (= R352) binding
- 334:340 (vs. 377:383, 29% identical) binding
- R336 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
7fgpA Crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form)
24% identity, 96% coverage: 4:400/414 of query aligns to 4:361/379 of 7fgpA
- binding flavin-adenine dinucleotide: G9 (= G9), G11 (= G11), V12 (≠ I12), I13 (≠ V13), E32 (≠ D32), A33 (≠ R33), T40 (= T40), S41 (= S41), V43 (≠ G43), S44 (≠ N44), Y45 (≠ A45), A46 (≠ G46), W47 (≠ L47), E97 (≠ S97), K179 (≠ D221), V180 (≠ A222), S210 (≠ L250), G211 (= G251), W213 (≠ Q253), R314 (= R352), H339 (= H377), S340 (≠ A378), G341 (= G381), V342 (≠ L382), T343 (= T383)
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 47% coverage: 217:412/414 of query aligns to 173:367/368 of 4yshB
- active site: I262 (≠ T309), L283 (= L331), G305 (= G350), N335 (≠ H380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (≠ A222), S206 (≠ L250), W209 (≠ Q253), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ H380), G336 (= G381), I337 (≠ L382), L338 (≠ T383)
- binding glycine: G249 (= G295), Y251 (≠ V297), Y251 (≠ V297), A264 (= A315), R307 (= R352), R334 (≠ H379), R334 (≠ H379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 47% coverage: 217:412/414 of query aligns to 173:367/370 of 4yshA
- active site: I262 (≠ T309), L283 (= L331), G305 (= G350), N335 (≠ H380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (≠ A222), S206 (≠ L250), G207 (= G251), W209 (≠ Q253), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ H380), G336 (= G381), I337 (≠ L382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
28% identity, 25% coverage: 312:413/414 of query aligns to 345:445/447 of 5fjnA
Sites not aligning to the query:
- active site: 67, 71, 72, 252
- binding 2-aminobenzoic acid: 252, 289
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73, 201, 230, 231, 233, 252, 254, 343
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
28% identity, 25% coverage: 312:413/414 of query aligns to 345:445/447 of 5fjmA
Sites not aligning to the query:
- active site: 67, 71, 72, 252
- binding flavin-adenine dinucleotide: 34, 35, 37, 38, 39, 57, 58, 59, 65, 66, 67, 70, 71, 72, 73, 201, 230, 231, 233, 252, 254, 343
Query Sequence
>PP_3596 FitnessBrowser__Putida:PP_3596
MHCQTLVLGAGIVGVSTALHLQARGRQVILIDRDEPGSGTSHGNAGLIERSSVIPYAFPR
QLSALLRYGLNRQPDVRYSLAHLPKAAPWLWRYWRQSAPGRLAGAAADMLPLVQRCVDEH
DALIAAAGLEGLVQAKGWIEVFRDPALFEQAKTDAKGLSRYGLRFEILECGQLQAREHQL
DATVVGGIHWLDPKTVNNPGALTRGYAALFLQRGGQFVHGDARSLRQANGQWRVESRRGP
ITADEVVACLGPQSADLFSGLGYQIPLAIKRGYHMHYSTRDGAQLEHSICDTQGGYVLAP
MARGVRLTTGIEFDAASAPGNQIQLGRCEALARKLFPALGDRLDDTPWLGRRPCLPDMRP
VIGPAPRHPGLWFNFGHAHHGLTLGPVCGRLLAELLTGEPPFTDPAPYSATRFD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory