Comparing PP_3598 FitnessBrowser__Putida:PP_3598 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7d53A Spua mutant - h221n with glu (see paper)
42% identity, 90% coverage: 14:254/269 of query aligns to 2:242/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
42% identity, 90% coverage: 14:254/269 of query aligns to 8:248/255 of 7d50B
7d4rB Spua native structure (see paper)
39% identity, 89% coverage: 16:254/269 of query aligns to 2:210/215 of 7d4rB
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
38% identity, 93% coverage: 13:262/269 of query aligns to 3:250/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
38% identity, 93% coverage: 13:262/269 of query aligns to 5:252/254 of P76038
3fijA Crystal structure of a uncharacterized protein lin1909
37% identity, 70% coverage: 67:255/269 of query aligns to 39:221/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 75% coverage: 52:254/269 of query aligns to 106:295/308 of O33341
3uowA Crystal structure of pf10_0123, a gmp synthetase from plasmodium falciparum
25% identity, 45% coverage: 114:234/269 of query aligns to 74:200/517 of 3uowA
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
28% identity, 46% coverage: 113:237/269 of query aligns to 353:486/506 of 1vcnA
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
27% identity, 46% coverage: 117:240/269 of query aligns to 97:198/693 of P49915
Sites not aligning to the query:
>PP_3598 FitnessBrowser__Putida:PP_3598
MSNSNIGNKQPSLRKPVVLMTMGSQERKGHDYQVMTHKYITPLVEFSDCVPVLVPTCCGT
EDLETYLDMADGVYLTGAGSNIDPALYGQENQTPGKGQDQNRDLFDIPLVKAAIKRGLPI
FGICRGMQEINVALGGDIYQKVYAEPGFNDHRENPEDPVEVQYAQVHGVKIQPGSWLHDT
LGTDEIRVNSLHGQGLHKLGAGIEAIARAEDGLVEAIHAPSISPFLFAVQWHPEWQAAKN
PDSIKIFQAFGDACRAQVRKAQIKRQHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory