SitesBLAST
Comparing PP_3622 FitnessBrowser__Putida:PP_3622 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 90% coverage: 68:745/751 of query aligns to 20:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (≠ G86), G39 (= G87), Q40 (= Q88), H41 (≠ G89), V42 (≠ P90), A45 (= A93), G79 (= G131), G80 (= G132), S81 (= S133), S83 (= S135), V84 (= V136), G374 (≠ F423), F375 (= F424), L379 (≠ F428), L499 (≠ W541), R500 (= R542), V624 (= V651), D625 (≠ N652), Q632 (= Q659), T687 (≠ G714), G688 (= G715), L689 (≠ I716), G690 (= G717), E691 (= E718)
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
27% identity, 46% coverage: 231:572/751 of query aligns to 27:409/797 of 1ffvB
- active site: Q231 (= Q393), V266 (≠ F428), P343 (vs. gap), I349 (≠ L515), R378 (≠ W541), C379 (≠ R542)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): G260 (= G422), G261 (≠ F423), F262 (= F424), G263 (= G425), A376 (≠ G539), R378 (≠ W541), C379 (≠ R542)
Sites not aligning to the query:
- active site: 751, 752
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 516, 517, 518, 520, 523, 556, 557, 558, 560, 561, 674, 678, 683, 686, 747, 748, 749, 750, 751
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
27% identity, 46% coverage: 231:572/751 of query aligns to 27:409/797 of 1ffuB
Sites not aligning to the query:
- active site: 751, 752
- binding cytidine-5'-diphosphate: 518, 520, 523, 558, 560, 561, 674, 676, 678, 683, 747, 748, 749, 750
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
27% identity, 46% coverage: 231:572/751 of query aligns to 33:415/803 of P19913
- R384 (≠ W541) modified: 4-hydroxyarginine
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 48% coverage: 214:572/751 of query aligns to 12:401/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
33% identity, 20% coverage: 598:746/751 of query aligns to 587:746/761 of 1rm6A
- active site: E718 (= E718), G719 (≠ P719)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): L646 (≠ V651), N647 (= N652), V651 (≠ I656), Q654 (= Q659), K714 (vs. gap), E715 (vs. gap), A716 (vs. gap), S717 (vs. gap), E718 (= E718)
Sites not aligning to the query:
- active site: 206, 241, 318, 322, 350
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 235, 236, 237, 238, 350, 473, 474, 475, 476, 513, 514, 515, 517, 518
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 48% coverage: 213:573/751 of query aligns to 4:381/420 of 3hrdE
- active site: Q207 (= Q393), L242 (≠ F428), R318 (≠ P509), H322 (≠ E513), R350 (= R542)
- binding calcium ion: T206 (≠ N392), N208 (≠ A394), D212 (≠ F398), K241 (≠ H427), L242 (≠ F428), D243 (≠ S432)
- binding pterin cytosine dinucleotide: G237 (≠ F423), F238 (= F424), R350 (= R542)
- binding selenium atom: F238 (= F424), A348 (≠ Y540), F349 (≠ W541), R350 (= R542)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
23% identity, 48% coverage: 213:573/751 of query aligns to 4:381/420 of 3hrdA
- active site: Q207 (= Q393), L242 (≠ F428), R318 (≠ P509), H322 (≠ E513), R350 (= R542)
- binding pterin cytosine dinucleotide: G236 (= G422), G237 (≠ F423), F238 (= F424), R350 (= R542)
- binding magnesium ion: T206 (≠ N392), N208 (≠ A394), D212 (≠ F398), K241 (≠ H427), L242 (≠ F428), D243 (≠ S432), T305 (= T496), Y308 (≠ L499), A309 (= A500), S346 (≠ L538)
- binding nicotinic acid: A314 (≠ E505), R318 (≠ P509), F352 (≠ V544)
- binding selenium atom: F238 (= F424), G239 (= G425), A348 (≠ Y540), F349 (≠ W541), R350 (= R542)
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
33% identity, 20% coverage: 598:746/751 of query aligns to 595:754/769 of O33819
- VGKALN 650:655 (≠ PGSIVN 647:652) binding
- KEAS 722:725 (vs. gap) binding
Sites not aligning to the query:
- 214 binding
- 244:245 binding
- 522:526 binding
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
23% identity, 48% coverage: 213:573/751 of query aligns to 5:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
26% identity, 34% coverage: 344:599/751 of query aligns to 156:401/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
25% identity, 51% coverage: 215:598/751 of query aligns to 2:387/701 of 4zohA
Sites not aligning to the query:
- active site: 668, 669
- binding pterin cytosine dinucleotide: 442, 443, 444, 446, 482, 484, 486, 487, 594, 595, 598, 602, 664, 665, 666, 667, 668
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 48% coverage: 212:573/751 of query aligns to 14:381/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
27% identity, 48% coverage: 212:573/751 of query aligns to 14:381/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
23% identity, 63% coverage: 184:657/751 of query aligns to 559:1053/1335 of G3X982
- A802 (≠ F423) binding
- A807 (≠ S432) mutation to V: No effect on kinetic constants with smaller substrates like benzaldehyde or phthalazine. Decreases substrate affinity and slightly increases catalytic efficiency for bulkier substrates like phenanthridine.
- Y885 (≠ T510) mutation to M: Slightly decreases substrate affinity but no effect on activity with smaller substrates like benzaldehyde or phthalazine. Increases catalytic efficiency with bulkier substrates like phenanthridine or more charged substrates like N1-methylnicotinamide.
- K889 (≠ G514) mutation to H: No effect on substrate affinity but decreases catalytic efficiency for smaller substrates like benzaldehyde or phthalazine. Increases substrate affinity and activity for bulkier substrates like phenanthridine.
- L1043 (≠ P647) binding
Sites not aligning to the query:
- 47 binding
- 52 binding
- 55 binding
- 77 binding
- 116 binding
- 117 binding
- 120 binding
- 152 binding
- 154 binding
- 264:271 binding
- 354 binding
- 358 binding
- 367 binding
- 411 binding
- 1199 binding
- 1266 E→Q: Loss of activity with different N-heterocyclic compounds as substrates. 60% reduction of activity with benzaldehyde.
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
23% identity, 63% coverage: 184:657/751 of query aligns to 506:995/1262 of 3zyvB
Sites not aligning to the query:
- active site: 1207, 1208
- binding flavin-adenine dinucleotide: 227, 229, 230, 231, 232, 233, 234, 267, 303, 304, 312, 313, 316, 317, 319, 325, 326, 366, 392, 393
- binding fe2/s2 (inorganic) cluster: 39, 41, 42, 44, 46, 49, 69, 71, 111, 112, 114, 146, 148
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
26% identity, 49% coverage: 205:572/751 of query aligns to 165:563/907 of 4usaA
- active site: I390 (≠ Q393), F425 (= F428), R501 (≠ E513), F505 (≠ L515), R533 (≠ L538)
- binding bicarbonate ion: R460 (= R466), A531 (= A536), F532 (≠ M537), Y535 (= Y540), Q539 (≠ L548)
- binding hydrocinnamic acid: I255 (≠ V284), F425 (= F428), F494 (≠ K506), L497 (≠ P509), Y535 (= Y540)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ F423), F421 (= F424), G422 (= G425), R533 (≠ L538)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding hydrocinnamic acid: 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
26% identity, 49% coverage: 205:572/751 of query aligns to 165:563/907 of 4us9A
- active site: I390 (≠ Q393), F425 (= F428), R501 (≠ E513), F505 (≠ L515), R533 (≠ L538)
- binding 3-phenylpropanal: I255 (≠ V284), F257 (vs. gap), P258 (vs. gap)
- binding bicarbonate ion: R460 (= R466), L498 (≠ T510), A531 (= A536), F532 (≠ M537), Y535 (= Y540), Q539 (≠ L548)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ F423), F421 (= F424), G422 (= G425), R533 (≠ L538)
Sites not aligning to the query:
- active site: 869, 870
- binding 3-phenylpropanal: 752
- binding bicarbonate ion: 890, 892
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
26% identity, 49% coverage: 205:572/751 of query aligns to 165:563/907 of 4us8A
- active site: I390 (≠ Q393), F425 (= F428), R501 (≠ E513), F505 (≠ L515), R533 (≠ L538)
- binding bicarbonate ion: R460 (= R466), L498 (≠ T510), A531 (= A536), F532 (≠ M537), Y535 (= Y540), Q539 (≠ L548)
- binding benzaldehyde: I255 (≠ V284), I255 (≠ V284), L394 (≠ M397), F425 (= F428), F425 (= F428), F425 (= F428), F425 (= F428), L497 (≠ P509), L497 (≠ P509), R501 (≠ E513), A531 (= A536), Y535 (= Y540), Y535 (= Y540)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ F423), F421 (= F424), G422 (= G425), R533 (≠ L538)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 38, 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding benzaldehyde: 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
26% identity, 49% coverage: 205:572/751 of query aligns to 165:563/907 of 4c7yA
- active site: I390 (≠ Q393), F425 (= F428), R501 (≠ E513), F505 (≠ L515), R533 (≠ L538)
- binding bicarbonate ion: R460 (= R466), L498 (≠ T510), A531 (= A536), Y535 (= Y540), Q539 (≠ L548)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): T420 (≠ F423), F421 (= F424), G422 (= G425), R533 (≠ L538)
Sites not aligning to the query:
- active site: 869, 870
- binding fe2/s2 (inorganic) cluster: 40, 41, 43, 45, 46, 48, 58, 60, 100, 101, 103, 137, 139
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 99, 139, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
Query Sequence
>PP_3622 FitnessBrowser__Putida:PP_3622
MNTPVDTPAELLRLQRGETVNLSRRRFLAGTAVGALVLGFGLPMGSARVQAAAAAAATAE
RGTQVPAFLEIRPDGTVRLLSPFMEGGQGPFTAMAQIVGEELDVDPAHFVVDSAPPGEAY
VVMENGMRITGGSMSVRMSYPTMRRLGALARGMLLQAGAEHLGVPVDELSTTPGNVVHTT
TGRSVPYGELAGRAMDLPVPDPASVKLRDPSQFRWIGKPVRRLDAYDKSTGKAQYCIDIK
VDGMLHAAVQHAPRLGMTVGSLRNEDQIKAMKGVHSVHQLPGAVAVVAERWWHAKRAVEA
IQVDWKEPAADSKVRPMPADFSSDAWREHLATVQGPSRDEENEGDIAGALANAKTKVEAS
YHNQYLNHAQLEPPSALARFNPDGSLDVWLPNQAPDMFRDDIARRTGLEPAQINLHSPLL
GGFFGRHFLYDSANPYPQAIALAKAVGRPVKLIWSREEEFLRDVLRPVAVVKFRAGLDAD
GMPVALEAVSATEGPTEALAGKQGEKIDPTALEGLSGKSYAIANKRIAQIYVKGPAMLGY
WRSVGNSLNDFFYESFLDELADKGGKDPFELRLHLLRDNPRLTNLLNAVADLSGGWKRGP
FTAEDGSKRARGVAMASPFGSEAAVIAEVSIDNGQVRVHDIWQAIDPGSIVNPAIIEHQV
NGAVALGLSQTLVEEAVYVDGKPRARNYDLYPILPPSRMARVHVRIIESGAKMGGIGEPP
LPAVAPAVANAVAQLTGQRVRSLPLSRHTFS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory