SitesBLAST
Comparing PP_3671 FitnessBrowser__Putida:PP_3671 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
36% identity, 97% coverage: 4:270/274 of query aligns to 15:285/288 of 4gieA
- active site: D55 (= D43), Y60 (= Y48), K85 (= K73), H118 (= H106)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (= W20), D55 (= D43), Y60 (= Y48), H118 (= H106), W119 (= W107), N148 (= N137), Q169 (= Q158), W195 (≠ Y184), S196 (≠ T185), P197 (= P186), L198 (= L187), S200 (≠ R189), L207 (vs. gap), A224 (≠ S210), I239 (= I226), P240 (= P227), K241 (= K228), S242 (≠ A229), R247 (≠ N234), E250 (≠ A237), N251 (= N238)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
36% identity, 97% coverage: 4:270/274 of query aligns to 4:274/277 of 4fziA
P14065 Glycerol 2-dehydrogenase (NADP(+)); Galactose-inducible crystallin-like protein 1; EC 1.1.1.156 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
36% identity, 97% coverage: 4:270/274 of query aligns to 12:307/312 of P14065
- Q29 (≠ P21) mutation to K: Decreases catalytic activity.
- Y56 (= Y48) mutation to L: Loss of catalytic activity.
- K264 (= K228) mutation to R: Decreases catalytic activity.
- N267 (≠ S231) mutation to Q: Decreases catalytic activity.
- R270 (≠ N234) mutation R->H,Y,K: Decreases catalytic activity.
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 97% coverage: 3:267/274 of query aligns to 4:268/275 of A0QV10
- K262 (≠ Q261) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
34% identity, 99% coverage: 2:271/274 of query aligns to 5:268/276 of Q9GV41
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
34% identity, 99% coverage: 2:271/274 of query aligns to 10:273/281 of 1vbjA
- active site: D52 (= D43), Y57 (= Y48), K82 (= K73), H115 (= H106)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G18), M27 (≠ T19), W28 (= W20), D52 (= D43), Y57 (= Y48), H115 (= H106), N145 (= N137), Q166 (= Q158), W192 (≠ Y184), S193 (≠ T185), P194 (= P186), L195 (= L187), Q197 (≠ R189), G198 (= G190), V201 (≠ A193), A218 (≠ S210), I233 (= I226), K235 (= K228), S236 (≠ A229), G237 (≠ S230), R241 (≠ N234), E244 (≠ A237), N245 (= N238)
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
37% identity, 95% coverage: 8:267/274 of query aligns to 12:270/275 of 3d3fA
- active site: D48 (= D43), Y53 (= Y48), K78 (= K73), H111 (= H106)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), F24 (≠ W20), D48 (= D43), Y53 (= Y48), H111 (= H106), S140 (≠ A136), N141 (= N137), Q162 (= Q158), W188 (≠ Y184), S189 (≠ T185), P190 (= P186), L191 (= L187), Q193 (≠ R189), L197 (≠ A193), I229 (= I226), K231 (= K228), S232 (≠ A229), K234 (≠ S231), R237 (≠ N234), E240 (≠ A237), N241 (= N238)
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
35% identity, 98% coverage: 4:271/274 of query aligns to 8:277/283 of 4g5dA
- active site: D48 (= D43), Y53 (= Y48), K78 (= K73), H111 (= H106)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), V23 (≠ T19), W24 (= W20), D48 (= D43), Y53 (= Y48), H111 (= H106), S148 (≠ A136), N149 (= N137), Q170 (= Q158), W196 (≠ Y184), S197 (≠ T185), P198 (= P186), L199 (= L187), Q201 (≠ R189), G202 (= G190), L205 (≠ A193), I237 (= I226), P238 (= P227), K239 (= K228), S240 (≠ A229), V241 (≠ S230), H242 (≠ S231), R245 (≠ N234), E248 (≠ A237), N249 (= N238)
A0QV09 Aldo-keto reductase MSMEG_2407/MSMEI_2346; AKR; AKR5H1; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 95% coverage: 12:271/274 of query aligns to 22:276/283 of A0QV09
- G196 (≠ T185) binding
- L198 (= L187) binding
- V200 (≠ R189) binding
- I236 (= I226) binding
- R238 (≠ K228) binding
- S239 (≠ A229) binding
- A240 (≠ S230) binding
- R244 (≠ N234) binding
- S247 (≠ A237) binding
- N248 (= N238) binding
- R274 (≠ A269) binding
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
35% identity, 95% coverage: 12:271/274 of query aligns to 13:267/274 of 2wzmA
- active site: D44 (= D43), Y49 (= Y48), K74 (= K73), H107 (= H106)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y184), G187 (≠ T185), P188 (= P186), L189 (= L187), G190 (≠ A188), V191 (≠ R189), G192 (= G190), L195 (≠ A193), A212 (≠ S210), I227 (= I226), R229 (≠ K228), S230 (≠ A229), R235 (≠ N234), N239 (= N238), R265 (≠ A269)
2vdgA Barley aldose reductase 1 complex with butanol (see paper)
30% identity, 95% coverage: 7:265/274 of query aligns to 7:284/308 of 2vdgA
- active site: D43 (= D43), Y48 (= Y48), K76 (= K73), H109 (= H106)
- binding 1-butanol: E47 (≠ A47), E123 (vs. gap), A124 (vs. gap), L283 (≠ V264)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), T19 (= T19), W20 (= W20), D43 (= D43), Y48 (= Y48), K76 (= K73), H109 (= H106), C154 (≠ A136), N155 (= N137), Q176 (= Q158), Y202 (= Y184), S203 (≠ T185), P204 (= P186), L205 (= L187), S207 (≠ R189), S208 (≠ G190), N211 (vs. gap), I245 (= I226), P246 (= P227), K247 (= K228), S248 (≠ A229), S249 (= S230), K250 (≠ S231), R253 (≠ N234), E256 (≠ A237), N257 (= N238), L283 (≠ V264)
Sites not aligning to the query:
2bgsA Holo aldose reductase from barley (see paper)
30% identity, 95% coverage: 7:265/274 of query aligns to 7:284/308 of 2bgsA
- active site: D43 (= D43), Y48 (= Y48), K76 (= K73), H109 (= H106)
- binding bicarbonate ion: W20 (= W20), Y48 (= Y48), H109 (= H106)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), T19 (= T19), W20 (= W20), D43 (= D43), Y48 (= Y48), C154 (≠ A136), N155 (= N137), Q176 (= Q158), Y202 (= Y184), S203 (≠ T185), P204 (= P186), L205 (= L187), S207 (≠ R189), I245 (= I226), P246 (= P227), K247 (= K228), S248 (≠ A229), K250 (≠ S231), R253 (≠ N234), E256 (≠ A237), N257 (= N238), L283 (≠ V264)
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
34% identity, 89% coverage: 7:250/274 of query aligns to 8:266/274 of 5danA
- active site: D53 (= D43), Y58 (= Y48), K84 (= K73), H117 (= H106)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (= T19), W21 (= W20), D53 (= D43), Y58 (= Y48), H117 (= H106), Q169 (= Q158), Y198 (= Y184), S199 (≠ T185), P200 (= P186), L201 (= L187), R203 (= R189), Y226 (≠ S210), I242 (= I226), P243 (= P227), K244 (= K228), G246 (≠ S230), R247 (≠ S231), H250 (≠ N234), E253 (≠ A237), N254 (= N238)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
34% identity, 89% coverage: 7:250/274 of query aligns to 9:267/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W20), Y59 (= Y48), W87 (= W75), H118 (= H106), R204 (= R189)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T21 (= T19), W22 (= W20), Y59 (= Y48), H118 (= H106), N149 (= N137), Q170 (= Q158), Y199 (= Y184), S200 (≠ T185), P201 (= P186), L202 (= L187), R204 (= R189), T205 (≠ G190), Y227 (≠ S210), I243 (= I226), P244 (= P227), K245 (= K228), G247 (≠ S230), R248 (≠ S231), H251 (≠ N234), E254 (≠ A237), N255 (= N238)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
34% identity, 89% coverage: 7:250/274 of query aligns to 9:267/275 of 6kikA
O80944 Aldo-keto reductase family 4 member C8; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 98% coverage: 1:269/274 of query aligns to 5:293/311 of O80944
3h7rA Crystal structure of the plant stress-response enzyme akr4c8 (see paper)
31% identity, 98% coverage: 1:269/274 of query aligns to 1:289/307 of 3h7rA
- active site: D39 (= D43), Y44 (= Y48), K73 (= K73), H106 (= H106)
- binding acetate ion: Y20 (≠ W20), Y44 (= Y48), H106 (= H106)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), T19 (= T19), Y20 (≠ W20), D39 (= D43), Y44 (= Y48), H106 (= H106), Q172 (= Q158), Y198 (= Y184), S199 (≠ T185), P200 (= P186), L201 (= L187), S203 (vs. gap), Q204 (vs. gap), R210 (= R189), A231 (≠ S210), L246 (≠ I226), P247 (= P227), K248 (= K228), S249 (≠ A229), S250 (= S230), R254 (≠ N234), E257 (≠ A237), N258 (= N238)
3wbwA Crystal structure of gox0644 in complex with NADPH
33% identity, 96% coverage: 4:267/274 of query aligns to 6:266/271 of 3wbwA
- active site: D45 (= D43), Y50 (= Y48), K71 (= K73), H104 (= H106)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), H104 (= H106), N136 (= N137), W183 (≠ Y184), R184 (≠ T185), P185 (= P186), L186 (= L187), L192 (≠ A193), A209 (≠ S210), K226 (= K228), S227 (≠ A229), V228 (≠ S230), R232 (≠ N234), E235 (≠ A237), N236 (= N238)
1q5mA Binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with NADPH (see paper)
32% identity, 98% coverage: 1:269/274 of query aligns to 4:310/322 of 1q5mA
- active site: D49 (= D43), Y54 (= Y48), K83 (= K73), H116 (= H106)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G18), T22 (= T19), Y23 (≠ W20), D49 (= D43), Y54 (= Y48), H116 (= H106), Q189 (= Q158), Y215 (= Y184), S216 (≠ T185), L218 (= L187), S220 (≠ R189), H221 (vs. gap), A252 (≠ S210), L267 (≠ I226), K269 (= K228), S270 (≠ A229), F271 (≠ S230), T272 (≠ S231), R275 (≠ N234), E278 (≠ A237), N279 (= N238)
1q13A Crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with NADP and testosterone (see paper)
32% identity, 98% coverage: 1:269/274 of query aligns to 4:310/322 of 1q13A
- active site: D49 (= D43), Y54 (= Y48), K83 (= K73), H116 (= H106)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G18), T22 (= T19), Y23 (≠ W20), D49 (= D43), Y54 (= Y48), H116 (= H106), Q189 (= Q158), Y215 (= Y184), S216 (≠ T185), L218 (= L187), S220 (≠ R189), H221 (vs. gap), L235 (vs. gap), A252 (≠ S210), L267 (≠ I226), K269 (= K228), S270 (≠ A229), T272 (≠ S231), R275 (≠ N234), E278 (≠ A237), N279 (= N238)
- binding testosterone: Y23 (≠ W20), F53 (≠ A47), Y54 (= Y48), H116 (= H106), P224 (vs. gap)
Query Sequence
>PP_3671 FitnessBrowser__Putida:PP_3671
MQRLSTRTGLDLPAIGLGTWPMTGSECTQAVRQALDVGYRHIDTATAYENEAAVGQALRD
SDVPREQIHLTTKVWWDRLEPKAMRQSLEDSLRALGTEQVDLFHIHWPGTDWDLARSIDT
LVALRDEGKARHIGVANFPLGLLRQVVETLGAPLSAIQVEYHVLLSQQPLLDFARGHDLL
LTAYTPLARGQAAAQPVIQAIARKHGVLPSQVALKWLLDQDGVAAIPKASSRENQLANLA
ALTVPLDDEDRTAIAGLPKDQRVVSPPFAPDWNS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory