Comparing PP_3718 FitnessBrowser__Putida:PP_3718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
48% identity, 88% coverage: 45:458/470 of query aligns to 32:438/444 of 3i5tA
Sites not aligning to the query:
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
43% identity, 94% coverage: 15:458/470 of query aligns to 5:453/455 of 5kr5A
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 96% coverage: 13:461/470 of query aligns to 7:460/460 of 5kr6B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
42% identity, 96% coverage: 13:461/470 of query aligns to 6:457/458 of 5kr3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
41% identity, 96% coverage: 13:461/470 of query aligns to 5:458/459 of 5kquC
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
41% identity, 94% coverage: 19:462/470 of query aligns to 10:450/450 of 6gwiB
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
44% identity, 91% coverage: 35:464/470 of query aligns to 26:454/454 of 7ypmA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
43% identity, 96% coverage: 12:464/470 of query aligns to 1:454/455 of 7ypnD
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 92% coverage: 15:448/470 of query aligns to 8:437/448 of 6io1B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
39% identity, 90% coverage: 41:461/470 of query aligns to 4:421/422 of 7qx3A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
38% identity, 94% coverage: 19:461/470 of query aligns to 9:442/443 of 7qx0B
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
38% identity, 95% coverage: 15:461/470 of query aligns to 3:442/443 of 6fyqA
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
37% identity, 95% coverage: 15:459/470 of query aligns to 3:447/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
37% identity, 95% coverage: 15:459/470 of query aligns to 3:447/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
37% identity, 95% coverage: 15:459/470 of query aligns to 3:447/453 of 6g4dB
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
37% identity, 96% coverage: 17:466/470 of query aligns to 7:453/453 of 6s4gA
7q9xAAA Probable aminotransferase
37% identity, 96% coverage: 17:466/470 of query aligns to 8:454/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
37% identity, 96% coverage: 17:466/470 of query aligns to 8:454/455 of 4a6tC
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
38% identity, 91% coverage: 41:466/470 of query aligns to 3:422/423 of 4a6rA
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
37% identity, 94% coverage: 10:451/470 of query aligns to 3:451/458 of 3fcrA
>PP_3718 FitnessBrowser__Putida:PP_3718
MATPSKAFAIAHDPLVEADKAHYMHGYHVFDEHREQGALNIVAGEGAYIRDTHGNRFLDA
VGGMWCTNIGLGREEMALAIVDQVRQLAYSNPFSDMANDVAIELCQKLAQLAPGDLNHVF
LTTGGSTAVDTAYRLIQYYQNCRGKPHKKHIIARYNAYHGSTTLTMSIGNKAADRVPEFD
YHHDLIHHVSNPNPYRAPDDMDEAEFLDFLVAEFEDKILSLGADNVAAFFAEPIMGSGGV
IIPPEGYFQRMWQLCQTYDILFVADEVVTSFGRLGTFFASEELFGVTPDIITTAKGLTSA
YLPLGACIFSERIWQVIAEPGKGRCFTHGFTYSGHPVCCTAALKNIEIIEREQLLDHVND
VGSYLEQRLQSLRDLPLVGDVRCMKLMACVEFVANKASKALFADEVNIGERIHSKAQEKG
LLVRPIMHLNVMSPPLIITHAQVDEIVETLRQCIIETARELTALGLYQGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory